TkA03G122880 | RubberDandelionOmics

Gene overview

TkA03G122880

Reference: TK1151 Chr: Chr03 Coordinates: 31436994-31437739 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

453 bp · TkA03G122880|TK1151|cDNA

ATGGGGATTTGGTTTCCGATTCAGGTGTACAGTGCCGATCTTCAGACCAGATTGGGGATCACAGCCGGAATATGTATTCTGATCAAGAACATGGGAGAAGAAGGTGACAGGTACGAGGCTATTTACAGCTTTCACTTGGGAGATTACGGGCAGATAGCAGTCCAGGGTGCGTACCTAACCACCGAGGACACTTACCTTACAATCACCGGCGGCACCGGGATCTTCGCCGGAGCGTACGGGCAAGTCAAGCTTCAGCAGCT...

CDS

Download CDS FASTA

453 bp · TkA03G122880|TK1151|CDS

ATGGGGATTTGGTTTCCGATTCAGGTGTACAGTGCCGATCTTCAGACCAGATTGGGGATCACAGCCGGAATATGTATTCTGATCAAGAACATGGGAGAAGAAGGTGACAGGTACGAGGCTATTTACAGCTTTCACTTGGGAGATTACGGGCAGATAGCAGTCCAGGGTGCGTACCTAACCACCGAGGACACTTACCTTACAATCACCGGCGGCACCGGGATCTTCGCCGGAGCGTACGGGCAAGTCAAGCTTCAGCAGCT...

Protein

Download Protein FASTA

150 aa · TkA03G122880|TK1151|PROTEIN

MGIWFPIQVYSADLQTRLGITAGICILIKNMGEEGDRYEAIYSFHLGDYGQIAVQGAYLTTEDTYLTITGGTGIFAGAYGQVKLQQLVFPFKLFYTFYLQGLSGDLPAELLVTPFPPSPAVEASPAAKAAEPGPQALTILIKVTIVIGTF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G122880`
TK1151 ID	TkA03G122880
OH-1004 ID	LXL04_007102
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.400
Protein coverage (%)	TK1151 86.000 / OH-1004 51.793 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G122880

Location Chr03:31436994-31437739 (-)

Description Similar to AOC: Allene oxide cyclase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25760`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid.	No verified direct reference in this release
`At3g25770`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid.	No verified direct reference in this release
`At3g25780`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XID3`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid (JA).	No verified direct reference in this release
`Os03g0438100`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid (JA).	Identification of rice Allene Oxide Cyclase mutants and the function of jasmonate for defence against Magnaporthe oryzae.2013 · DOI: 10.1111/tpj.12115 Increased tolerance to salt stress in OPDA-deficient rice ALLENE OXIDE CYCLASE mutants is linked to an increased ROS-scavenging activity.2015 · DOI: 10.1093/jxb/erv142

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007102 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009625 response to insect Biological Process

GO:0009637 response to blue light Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

KEGG gene cross-reference

ath:AT1G13280

ath:AT3G25770

ath:AT3G25780

dosa:Os03g0438100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.286

Rank 1 · TkA03G122880 · TK1151

Lysosome / Vacuole0.264

Rank 2 · TkA03G122880 · TK1151

Endoplasmic reticulum0.192

Rank 3 · TkA03G122880 · TK1151

Cytoplasm0.130

Rank 4 · TkA03G122880 · TK1151

Golgi apparatus0.099

Rank 5 · TkA03G122880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06351Allene_ox_cyc5-133 aa

PF18678AOC_like15-87 aa

PF03018Dirigent50-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G122880	`PF06351`	Allene_ox_cyc	5	133	3.1e-60	203.6
TkA03G122880	`PF18678`	AOC_like	15	87	0.00045	20.7
TkA03G122880	`PF03018`	Dirigent	50	86	0.014	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS03`	Arabidopsis thaliana	sp\|Q9LS03\|AOC1_ARATH Allene oxide cyclase 1, chloroplastic	62.800%	Swiss-Prot	High
`Q9LS02`	Arabidopsis thaliana	sp\|Q9LS02\|AOC2_ARATH Allene oxide cyclase 2, chloroplastic	62.000%	Swiss-Prot	High
`Q9LS01`	Arabidopsis thaliana	sp\|Q9LS01\|AOC3_ARATH Allene oxide cyclase 3, chloroplastic	61.200%	Swiss-Prot	High
`A2XID3`	Oryza sativa subsp. indica	sp\|A2XID3\|AOC_ORYSI Allene oxide cyclase, chloroplastic	67.400%	Swiss-Prot	High
`Q75KD7`	Oryza sativa subsp. japonica	sp\|Q75KD7\|AOC_ORYSJ Allene oxide cyclase, chloroplastic	67.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card