LXL04_007102 | RubberDandelionOmics

Gene overview

LXL04_007102

Reference: OH-1004 Chr: Chr02 Coordinates: 36140500-36141455 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

756 bp · LXL04_007102|LXL04_007102|OH1004|cDNA

ATGGCTGCTGCTACTTCATCTTCTTTGCAATCAATCCCTTCCTCTCTCAAGTTATTACGCACCGCCGGGGCAACCACCGGCGCAGCTCCTAACCTCCTGTCGTTTAAGAACTCCGCTAACCCGGTTTTCTCTCATAATCTGATTGCCACAGCCACAGCCAAATCTTCCGGCAGCCGGAGATGGTTTGGTGCCAAGAGTCAATCCAACCCATCAAATTCTTCGAGACCCGCGAAAGTGCAGGAACTCAGTGTGTATGAGCT...

CDS

Download CDS FASTA

756 bp · LXL04_007102|LXL04_007102|OH1004|CDS

ATGGCTGCTGCTACTTCATCTTCTTTGCAATCAATCCCTTCCTCTCTCAAGTTATTACGCACCGCCGGGGCAACCACCGGCGCAGCTCCTAACCTCCTGTCGTTTAAGAACTCCGCTAACCCGGTTTTCTCTCATAATCTGATTGCCACAGCCACAGCCAAATCTTCCGGCAGCCGGAGATGGTTTGGTGCCAAGAGTCAATCCAACCCATCAAATTCTTCGAGACCCGCGAAAGTGCAGGAACTCAGTGTGTATGAGCT...

Protein

Download Protein FASTA

251 aa · LXL04_007102|LXL04_007102|OH1004|PROTEIN

MAAATSSSLQSIPSSLKLLRTAGATTGAAPNLLSFKNSANPVFSHNLIATATAKSSGSRRWFGAKSQSNPSNSSRPAKVQELSVYELNERDRGSPAYLRLGQKPVNSLGDLVPFTNKVYSADLQTRLGITAGICILIKNMPEKKGDRYEAIYSFHLGDYGQIAVQGAYLTTEDTYLTITGGTGIFAGAYGQVKLQQLVFPFKLFYTFYLQGLSGDLPAELLVTPFPPSPAVEASPAAKAAEPGATSPNYTD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007102`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007102

Location Chr02:36140500-36141455 (-)

Description Similar to AOC: Allene oxide cyclase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25780`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid.	No verified direct reference in this release
`At1g13280`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid.	No verified direct reference in this release
`At3g25770`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0438100`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid (JA).	Identification of rice Allene Oxide Cyclase mutants and the function of jasmonate for defence against Magnaporthe oryzae.2013 · DOI: 10.1111/tpj.12115 Increased tolerance to salt stress in OPDA-deficient rice ALLENE OXIDE CYCLASE mutants is linked to an increased ROS-scavenging activity.2015 · DOI: 10.1093/jxb/erv142
`UniProt: A2XID3`	Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid (JA).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007102 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009625 response to insect Biological Process

GO:0009637 response to blue light Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

KEGG gene cross-reference

ath:AT1G13280

ath:AT3G25770

ath:AT3G25780

dosa:Os03g0438100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.983

Rank 1 · LXL04_007102 · OH-1004

Nucleus0.018

Rank 2 · LXL04_007102 · OH-1004

Mitochondrion0.015

Rank 3 · LXL04_007102 · OH-1004

Cytoplasm0.014

Rank 4 · LXL04_007102 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_007102 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06351.17Allene_ox_cyc75-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007102	`PF06351.17`	Allene_ox_cyc	75	249	3.8e-87	291.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS01`	Arabidopsis thaliana	Allene oxide cyclase 3, chloroplastic	61.458%	Swiss-Prot	strong database homology
`Q93ZC5`	Arabidopsis thaliana	Allene oxide cyclase 4, chloroplastic	56.164%	Swiss-Prot	strong database homology
`Q9LS02`	Arabidopsis thaliana	Allene oxide cyclase 2, chloroplastic	58.373%	Swiss-Prot	strong database homology
`Q75KD7`	Oryza sativa subsp. japonica	Allene oxide cyclase, chloroplastic	68.508%	Swiss-Prot	strong database homology
`A2XID3`	Oryza sativa subsp. indica	Allene oxide cyclase, chloroplastic	68.508%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card