TkA03G122500 | RubberDandelionOmics

Gene overview

TkA03G122500

Reference: TK1151 Chr: Chr03 Coordinates: 31313394-31316799 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1397 bp · TkA03G122500|TK1151|cDNA

CTTGTGGTGCGTTTTCTTTCCAAATTTTCCTTGGGGTTGAACCACATAACTCAAGTCCTAACTCCGGCAGGCAAAGGATAGGGTCAAACTCGTGTGTATCGCCCGCCCTGCGTGTAGCCAACTCCGCCCCTAAGAATACAGCTGTCGCCATCTCATTGGATTATTCCTCCTCGCTTTCACGCGTTTCCATTATATAAACCCCTCGAATCCGCTTCTTTGCATTCTCCTTCGATCAAAGAGTATCACACACACAAACACCT...

CDS

Download CDS FASTA

777 bp · TkA03G122500|TK1151|CDS

ATGGCATCCGAAGCTTCACGTGAGGAAAATGTGTACATGGCGAAGCTTGCAGAGCAAGCCGAAAGGTACGAAGAAATGGTTGAGTTCATGGAGAAGGTCGCCAAGACTGTTGACGTTGAGGAACTCACAGTAGAAGAAAGAAACCTCCTCTCTGTTGCTTACAAGAACGTAATTGGAGCCAGGAGGGCATCATGGAGGATCATATCTTCAATTGAACAGAAAGAAGAGAGCCGTGGGAATGAAGACCATGTCAAACTAAT...

Protein

Download Protein FASTA

258 aa · TkA03G122500|TK1151|PROTEIN

MASEASREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVKLIKDYRSTIETELSKICDGILGLLESHLVPSASSAESKIFYLKMKGDYFRYLAEFKTGAERKEAAESTLLAYKSAQDIALSDLAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDIADETGDEIKETTKAEEAQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G122500`
TK1151 ID	TkA03G122500
OH-1004 ID	LXL04_007098
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G122500

Location Chr03:31313394-31316799 (+)

Description Similar to 14-3-3-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02520`	Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007098 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0007165 signal transduction Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0019222 regulation of metabolic process Biological Process

GO:0050826 response to freezing Biological Process

GO:0051365 cellular response to potassium ion starvation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G02520

ath:AT5G38480

sly:543791

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.739

Rank 1 · TkA03G122500 · TK1151

Nucleus0.361

Rank 2 · TkA03G122500 · TK1151

Cell membrane0.070

Rank 3 · TkA03G122500 · TK1151

Golgi apparatus0.063

Rank 4 · TkA03G122500 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA03G122500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF0024414-3-313-237 aa

PF07295DUF145122-53 aa

PF07295DUF1451205-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G122500	`PF00244`	14-3-3	13	237	6.4e-105	350.4
TkA03G122500	`PF07295`	DUF1451	22	53	2.9	8.8
TkA03G122500	`PF07295`	DUF1451	205	253	2.9	8.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96300`	Arabidopsis thaliana	sp\|Q96300\|14337_ARATH 14-3-3-like protein GF14 nu	89.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card