Gene Card
Gene overview
cDNA / CDS / Protein Sequences
777 bp · LXL04_007098|LXL04_007098|OH1004|cDNA
ATGGCATCCGAAGCTTCACGTGAGGAAAATGTGTACATGGCGAAGCTTGCAGAGCAAGCCGAAAGGTACGAAGAAATGGTTGAGTTCATGGAGAAGGTCGCCAAGACTGTTGACGTTGAGGAACTCACAGTAGAAGAAAGAAACCTCCTCTCTGTTGCTTACAAGAACGTAATTGGAGCCAGGAGGGCATCATGGAGGATCATATCTTCAATTGAACAGAAAGAAGAGAGCCGTGGGAATGAAGACCATGTCAAACTAAT...
777 bp · LXL04_007098|LXL04_007098|OH1004|CDS
ATGGCATCCGAAGCTTCACGTGAGGAAAATGTGTACATGGCGAAGCTTGCAGAGCAAGCCGAAAGGTACGAAGAAATGGTTGAGTTCATGGAGAAGGTCGCCAAGACTGTTGACGTTGAGGAACTCACAGTAGAAGAAAGAAACCTCCTCTCTGTTGCTTACAAGAACGTAATTGGAGCCAGGAGGGCATCATGGAGGATCATATCTTCAATTGAACAGAAAGAAGAGAGCCGTGGGAATGAAGACCATGTCAAACTAAT...
Protein
Download Protein FASTA258 aa · LXL04_007098|LXL04_007098|OH1004|PROTEIN
MASEASREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVKLIKDYRSTIETELSKICDGILGLLESHLVPSASSAESKIFYLKMKGDYFRYLAEFKTGAERKEAAESTLLAYKSAQDIALSDLAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEDSYKDSTLIMQLLRDNLTLWTSDIADETGDEIKETTKAEEAQ
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_007098 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_007098 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:36052110-36053154 (+) | |||||||||
| Description | Similar to 14-3-3-like protein | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006995 cellular response to nitrogen starvation Biological Process GO:0007165 signal transduction Biological Process GO:0008104 intracellular protein localization Biological Process GO:0009409 response to cold Biological Process GO:0009631 cold acclimation Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0019222 regulation of metabolic process Biological Process GO:0050826 response to freezing Biological Process GO:0051365 cellular response to potassium ion starvation Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G02520 ath:AT5G38480 sly:543791 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00244.2714-3-313-237 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_007098 | PF00244.27 | 14-3-3 | 13 | 237 | 6.4e-105 | 350.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.