TkA03G108110 | RubberDandelionOmics

Gene overview

TkA03G108110

Reference: TK1151 Chr: Chr03 Coordinates: 27667930-27678902 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1100 bp · TkA03G108110|TK1151|cDNA

TACTTTTCTAGATATGGCTTCACAACCTCCAAGTGATAGGGGTCCAGGAAAAAATAAACGGAAGTGGAACGAGATAGAAGACGAGAAACTTGTTGAAGCTATGATGGATATACTTAATTCGGGTTCTCATTATAAATTAGACAATGGTTTTAAGCCCGGGTTCTTTGGTGCGGTGGAAACCCGACTCGCAGTATCACTTCCCAACTCGGGAATAAAAGCAAAGCCACATATAGAGTCACGCATAAAAACTTTGAAGAGCG...

CDS

Download CDS FASTA

897 bp · TkA03G108110|TK1151|CDS

ATGGCTTCACAACCTCCAAGTGATAGGGGTCCAGGAAAAAATAAACGGAAGTGGAACGAGATAGAAGACGAGAAACTTGTTGAAGCTATGATGGATATACTTAATTCGGGTTCTCATTATAAATTAGACAATGGTTTTAAGCCCGGGTTCTTTGGTGCGGTGGAAACCCGACTCGCAGTATCACTTCCCAACTCGGGAATAAAAGCAAAGCCACATATAGAGTCACGCATAAAAACTTTGAAGAGCGATTGGTCTGCTAT...

Protein

Download Protein FASTA

298 aa · TkA03G108110|TK1151|PROTEIN

MASQPPSDRGPGKNKRKWNEIEDEKLVEAMMDILNSGSHYKLDNGFKPGFFGAVETRLAVSLPNSGIKAKPHIESRIKTLKSDWSAIHDMMSWNNTSGFGWDYGNNMLDASQSIWQAYAQVHKNAAKWRGKKFPHYWDLCLVFGKDRANGRDAQTAADVISEMNNEQEEPIDSTQGSGDGLEDIHVDGPLNTPTETPVIEESSSQLNKKRKNTWDHLMRSLKDSAAIIGSKIDNATSTFDAVFGIERDREELRKKLNSEM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G108110`
TK1151 ID	TkA03G108110
OH-1004 ID	LXL04_039101
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.600
Protein coverage (%)	TK1151 100.000 / OH-1004 49.175 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G108110`
Location	Chr03:27667930-27678902 (-)
Description	Similar to HARBI1: Putative nuclease HARBI1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039101` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0034451 centriolar satellite Cellular Component GO:0004518 nuclease activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT2G29880 bta:514442 hsa:283254 mmu:241547 rno:690164 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA03G108110 · TK1151

Cytoplasm0.104

Rank 2 · TkA03G108110 · TK1151

Cell membrane0.015

Rank 3 · TkA03G108110 · TK1151

Mitochondrion0.012

Rank 4 · TkA03G108110 · TK1151

Extracellular0.011

Rank 5 · TkA03G108110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12776Myb_DNA-bind_317-118 aa

PF10343Q_salvage113-174 aa

PF12776Myb_DNA-bind_3208-229 aa

PF10343Q_salvage225-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G108110	`PF12776`	Myb_DNA-bind_3	17	118	1.6e-09	39.3
TkA03G108110	`PF10343`	Q_salvage	113	174	0.17	12.1
TkA03G108110	`PF12776`	Myb_DNA-bind_3	208	229	1.6e-09	39.3
TkA03G108110	`PF10343`	Q_salvage	225	264	0.17	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card