LXL04_039101 | RubberDandelionOmics

Gene overview

LXL04_039101

Reference: OH-1004 Chr: Chr09 Coordinates: 59311911-59315399 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1821 bp · LXL04_039101|LXL04_039101|OH1004|cDNA

ATGTTAGGCTTTACCTGTGACGAATTGGTTTCAGTTGTAAATTCCGTTCAAGAATCTTTCATCAATTTCATTCAAGAATCTTTCATCAATTTTGTTCAAGAAAAACATATCTTCGCAGCTAGACGACCCTACAAGTTGTTACACCCAGAGAGAAAAGAGTATATGCACAGATTAGTGTATGAAAGTGATGATACTTGTCTCCAACAATTAAGGATGAATAGAACAGCGTTTGTTAAGTTGTGTCGTATGATTGAGATTGA...

CDS

Download CDS FASTA

1821 bp · LXL04_039101|LXL04_039101|OH1004|CDS

ATGTTAGGCTTTACCTGTGACGAATTGGTTTCAGTTGTAAATTCCGTTCAAGAATCTTTCATCAATTTCATTCAAGAATCTTTCATCAATTTTGTTCAAGAAAAACATATCTTCGCAGCTAGACGACCCTACAAGTTGTTACACCCAGAGAGAAAAGAGTATATGCACAGATTAGTGTATGAAAGTGATGATACTTGTCTCCAACAATTAAGGATGAATAGAACAGCGTTTGTTAAGTTGTGTCGTATGATTGAGATTGA...

Protein

Download Protein FASTA

606 aa · LXL04_039101|LXL04_039101|OH1004|PROTEIN

MLGFTCDELVSVVNSVQESFINFIQESFINFVQEKHIFAARRPYKLLHPERKEYMHRLVYESDDTCLQQLRMNRTAFVKLCRMIEIDGKLKASRYLQIDEQVAIFLHVLAHHVKNRVVKFQFRRSGETVSKHFNNVVNAVIRLERKLFKKPEPISETSTNERWKWFKGCLGAIDGTHISVHVPEKDIPRYRNRKGEITTNVLAACTPDMQFIYVLPGWEGSAADGRILRSAMLRENGLQVSKGNYYLVDAGYTNGEGFLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039101`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039101

Location Chr09:59311911-59315399 (+)

Description Similar to HARBI1: Putative nuclease HARBI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29880`	Uncharacterized protein At2g29880.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039101 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0034451 centriolar satellite Cellular Component

GO:0004518 nuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G29880

bta:514442

hsa:283254

mmu:241547

rno:690164

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · LXL04_039101 · OH-1004

Cytoplasm0.114

Rank 2 · LXL04_039101 · OH-1004

Cell membrane0.016

Rank 3 · LXL04_039101 · OH-1004

Mitochondrion0.015

Rank 4 · LXL04_039101 · OH-1004

Extracellular0.010

Rank 5 · LXL04_039101 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26138.1DUF804051-141 aa

PF01609.28DDE_Tnp_1166-268 aa

PF13359.13DDE_Tnp_4173-299 aa

PF12776.14Myb_DNA-bind_3315-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039101	`PF26138.1`	DUF8040	51	141	7.9e-25	87.3
LXL04_039101	`PF01609.28`	DDE_Tnp_1	166	268	5.8e-06	26.9
LXL04_039101	`PF13359.13`	DDE_Tnp_4	173	299	2.7e-19	70.1
LXL04_039101	`PF12776.14`	Myb_DNA-bind_3	315	416	2.7e-10	41.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82368`	Arabidopsis thaliana	Uncharacterized protein At2g29880	25.763%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card