TkA03G104760 | RubberDandelionOmics

Gene overview

TkA03G104760

Reference: TK1151 Chr: Chr03 Coordinates: 26802754-26805178 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1322 bp · TkA03G104760|TK1151|cDNA

TTCCTTCGCCCGTCATCTCTTTGTCAGCTGCTTTCGGTCTCTATCTGCAAATCTCTCATCTTTTCTCTCTCTCTAGGGTTTCTTTCTCTCTACATCTTCAAAATTTGTTTCTCACAAAATCATCTTCCGACCATGGCTGGAGCTCGATTACCACCGGAAGACAACGATGCCTCACAGGTACGGCTGCTGCCGACTACCGATCTGATCTCAGATGATGACCGCTCAGTTGCTGCTGACTCTTGGTCCATCAAAAGTGACTA...

CDS

Download CDS FASTA

1122 bp · TkA03G104760|TK1151|CDS

TTCCTTCGCCCGTCATCTCTTTGTCAGCTGCTTTCGGTCTCTATCTGCAAATCTCTCATCTTTTCTCTCTCTCTAGGGTTTCTTTCTCTCTACATCTTCAAAATTTGTTTCTCACAAAATCATCTTCCGACCATGGCTGGAGCTCGATTACCACCGGAAGACAACGATGCCTCACAGGTACGGCTGCTGCCGACTACCGATCTGATCTCAGATGATGACCGCTCAGTTGCTGCTGACTCTTGGTCCATCAAAAGTGACTA...

Protein

Download Protein FASTA

373 aa · TkA03G104760|TK1151|PROTEIN

FLRPSSLCQLLSVSICKSLIFSLSLGFLSLYIFKICFSQNHLPTMAGARLPPEDNDASQVRLLPTTDLISDDDRSVAADSWSIKSDYGSTLDDDQRHADASEALAAAPYRTASDYSSDKEEPDAETITSMLGFQSYWDTAYADELTNFREHGHAGEVWFGADVMEMVASWTKGLCDDIFKKEVENHHDNDNSEFKKDLGAWSVLDVGTGNGLLLQELSKQGFSDLTGTDYSEGAIDLAQNLANRDGFDTIKFLVDDILET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G104760`
TK1151 ID	TkA03G104760
OH-1004 ID	LXL04_007031
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 94.906 / OH-1004 96.477 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G104760`
Location	Chr03:26802754-26805178 (-)
Description	Similar to EEF1AKMT2: EEF1A lysine methyltransferase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007031` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006417 regulation of translation Biological Process GO:0006479 protein methylation Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0018022 peptidyl-lysine methylation Biological Process GO:0032259 methylation Biological Process GO:2000765 regulation of cytoplasmic translation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0008168 methyltransferase activity Molecular Function GO:0016279 protein-lysine N-methyltransferase activity Molecular Function
KEGG gene cross-reference	dre:503749 hsa:399818 mmu:72096 sce:YIL064W spo:2541223 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.632

Rank 1 · TkA03G104760 · TK1151

Nucleus0.544

Rank 2 · TkA03G104760 · TK1151

Mitochondrion0.063

Rank 3 · TkA03G104760 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA03G104760 · TK1151

Cell membrane0.039

Rank 5 · TkA03G104760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03848TehB195-315 aa

PF13679Methyltransf_32195-282 aa

PF06325PrmA201-255 aa

PF13847Methyltransf_31202-326 aa

PF13489Methyltransf_23202-315 aa

PF05175MTS202-270 aa

PF13649Methyltransf_25203-303 aa

PF08241Methyltransf_11204-307 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G104760	`PF03848`	TehB	195	315	0.00071	19.8
TkA03G104760	`PF13679`	Methyltransf_32	195	282	0.083	13.6
TkA03G104760	`PF06325`	PrmA	201	255	0.0028	17.9
TkA03G104760	`PF13847`	Methyltransf_31	202	326	1.8e-17	64.2
TkA03G104760	`PF13489`	Methyltransf_23	202	315	2.2e-09	38.0
TkA03G104760	`PF05175`	MTS	202	270	2.6e-05	24.6
TkA03G104760	`PF13649`	Methyltransf_25	203	303	1.7e-11	45.4
TkA03G104760	`PF08241`	Methyltransf_11	204	307	2e-09	38.7
TkA03G104760	`PF08242`	Methyltransf_12	204	305	9.4e-09	36.6
TkA03G104760	`PF29244`	Methyltransf_ANTKMT	205	264	0.004	18.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card