LXL04_007031 | RubberDandelionOmics

Gene overview

LXL04_007031

Reference: OH-1004 Chr: Chr02 Coordinates: 34133158-34135419 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1130 bp · LXL04_007031|LXL04_007031|OH1004|cDNA

TTCCTTCGCCCGTCATCTCTTTGTCAGCTGCTTTCGGTCTCTATCTGCAAATCTCTCatcttttctctctctctctagggtttctttcTCTCTACATCTTCAAAATTTGTTTCTCACAAAATCATCTTCCGACCATGGCTGGAGCTCGATTACCACCGGAAGACAACGATGCCTCACAGGTAAGGCTGCTGCCGACTACCGATCTGATCTCAGATGATGACCGCTCAGTTGCTGCTGACTCTTGGTCCATCAAAAGTGAC...

CDS

Download CDS FASTA

1110 bp · LXL04_007031|LXL04_007031|OH1004|CDS

TTGTCAGCTGCTTTCGGTCTCTATCTGCAAATCTCTCATCTTTTCTCTCTCTCTCTAGGGTTTCTTTCTCTCTACATCTTCAAAATTTGTTTCTCACAAAATCATCTTCCGACCATGGCTGGAGCTCGATTACCACCGGAAGACAACGATGCCTCACAGGTAAGGCTGCTGCCGACTACCGATCTGATCTCAGATGATGACCGCTCAGTTGCTGCTGACTCTTGGTCCATCAAAAGTGACTACGGAAGTACTCTTGACGA...

Protein

Download Protein FASTA

369 aa · LXL04_007031|LXL04_007031|OH1004|PROTEIN

MSAAFGLYLQISHLFSLSLGFLSLYIFKICFSQNHLPTMAGARLPPEDNDASQVRLLPTTDLISDDDRSVAADSWSIKSDYGSTLDDDQRHADASEALAAAPYRTASDYSSDKEEPDAETITSMLGFQSYWDTAYADELTNFREHGHAGEVWFGADVMEMVASWTKGLCDDISKKEVENHHDNDNSEFKKDLGAWSVLDVGTGNGLLLQELSKQGFSDLTGTDYSEGAIDLAQNLANRDGFDTIKFLVDDILETKLDKKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007031`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_007031`
Location	Chr02:34133158-34135419 (-)
Description	Similar to EEF1AKMT2: EEF1A lysine methyltransferase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007031` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006417 regulation of translation Biological Process GO:0006479 protein methylation Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0018022 peptidyl-lysine methylation Biological Process GO:0032259 methylation Biological Process GO:2000765 regulation of cytoplasmic translation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0008168 methyltransferase activity Molecular Function GO:0016279 protein-lysine N-methyltransferase activity Molecular Function
KEGG gene cross-reference	dre:503749 hsa:399818 mmu:72096 sce:YIL064W spo:2541223 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.639

Rank 1 · LXL04_007031 · OH-1004

Nucleus0.576

Rank 2 · LXL04_007031 · OH-1004

Mitochondrion0.059

Rank 3 · LXL04_007031 · OH-1004

Endoplasmic reticulum0.036

Rank 4 · LXL04_007031 · OH-1004

Cell membrane0.033

Rank 5 · LXL04_007031 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13847.13Methyltransf_31196-322 aa

PF13489.13Methyltransf_23196-311 aa

PF13649.13Methyltransf_25197-270 aa

PF08241.19Methyltransf_11198-303 aa

PF08242.19Methyltransf_12198-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007031	`PF13847.13`	Methyltransf_31	196	322	1.4e-17	64.6
LXL04_007031	`PF13489.13`	Methyltransf_23	196	311	3.1e-09	37.5
LXL04_007031	`PF13649.13`	Methyltransf_25	197	270	2.8e-11	44.7
LXL04_007031	`PF08241.19`	Methyltransf_11	198	303	2.7e-09	38.2
LXL04_007031	`PF08242.19`	Methyltransf_12	198	301	6e-09	37.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card