Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1110 bp · TkA03G104750|TK1151|cDNA
ATGGCAATTATCACCGGTAGTTGGATTGTTGGAGCAGAAATATCTTCAACTAATGGCGATTGTCACAGGGAATTGGAGGAGTCTCAAATCAGAGTTCAAAGATGGGAAATAACAGAGCAAGTGATGATTCCTCTTGGTAGACTGCTGTCGTCGCCTCCACCACCTCCGCTGTCACGACAGATACCGCCGAGAATCGATGAAATGAACGAAGGAACGGCTCAGAGTTTGACGATAGAGTACAAACGGAACGTCATTGTGGG...
1110 bp · TkA03G104750|TK1151|CDS
ATGGCAATTATCACCGGTAGTTGGATTGTTGGAGCAGAAATATCTTCAACTAATGGCGATTGTCACAGGGAATTGGAGGAGTCTCAAATCAGAGTTCAAAGATGGGAAATAACAGAGCAAGTGATGATTCCTCTTGGTAGACTGCTGTCGTCGCCTCCACCACCTCCGCTGTCACGACAGATACCGCCGAGAATCGATGAAATGAACGAAGGAACGGCTCAGAGTTTGACGATAGAGTACAAACGGAACGTCATTGTGGG...
Protein
Download Protein FASTA369 aa · TkA03G104750|TK1151|PROTEIN
MAIITGSWIVGAEISSTNGDCHRELEESQIRVQRWEITEQVMIPLGRLLSSPPPPPLSRQIPPRIDEMNEGTAQSLTIEYKRNVIVGMLVPSMDVTEEITSLGHCILELKKKTRTKIRELGPLKMDQTPNLIGKVFNSSPSVIKSVMTLHIKVKIKLKPRTIESTTSTVCTSSPLLIDTPLPTFFLSETTILLAATLAIFSDLVSKTLVFKLVAVEKVTFWAEIKHLMRVISNTIYTKDMFLRVFIISFTAAPRKILFKI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G104750 |
|---|---|
| TK1151 ID | TkA03G104750 |
| OH-1004 ID | LXL04_014130 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 92.300 |
| Protein coverage (%) | TK1151 94.851 / OH-1004 45.515Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G104750 |
|---|---|
| Location | Chr03:26800296-26801405 (-) |
| Description | Similar to HSP83A: Heat shock protein 83 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0006952 defense response Biological Process GO:0009408 response to heat Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009908 flower development Biological Process GO:0010187 negative regulation of seed germination Biological Process GO:0010286 heat acclimation Biological Process GO:0034605 cellular response to heat Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045087 innate immune response Biological Process GO:0046685 response to arsenic-containing substance Biological Process |
| KEGG gene cross-reference | ath:AT5G52640 ath:AT5G56000 ath:AT5G56010 ath:AT5G56030 ini:109146489 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF19909DUF6382182-241 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G104750 | PF19909 | DUF6382 | 182 | 241 | 0.12 | 12.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.