LXL04_014130 | RubberDandelionOmics

Gene overview

LXL04_014130

Reference: OH-1004 Chr: Chr03 Coordinates: 42435255-42437545 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2277 bp · LXL04_014130|LXL04_014130|OH1004|cDNA

ATGGTTCAAGCTCATATCAATGCATTTCAAACGATGATGGCTCGTGCACGAGAAGAAGAGCAAGCATTCCGGAAAGTTCTGATTGCTTGGATGAAGCAACATGACCCAGGGTTTTCAGAATTCTATTCTGAATGGTCAATCCAACACCCGACCTCCCAATTTGCTGAAGCTACGAGTATCTGTTCATCAGATATTAGCAATGTTTCAGATCCGACGTCATCTTTTGTTTTAGATTCATCAGGTAATTTTCCGGCCACTTT...

CDS

Download CDS FASTA

2277 bp · LXL04_014130|LXL04_014130|OH1004|CDS

ATGGTTCAAGCTCATATCAATGCATTTCAAACGATGATGGCTCGTGCACGAGAAGAAGAGCAAGCATTCCGGAAAGTTCTGATTGCTTGGATGAAGCAACATGACCCAGGGTTTTCAGAATTCTATTCTGAATGGTCAATCCAACACCCGACCTCCCAATTTGCTGAAGCTACGAGTATCTGTTCATCAGATATTAGCAATGTTTCAGATCCGACGTCATCTTTTGTTTTAGATTCATCAGGTAATTTTCCGGCCACTTT...

Protein

Download Protein FASTA

758 aa · LXL04_014130|LXL04_014130|OH1004|PROTEIN

MVQAHINAFQTMMARAREEEQAFRKVLIAWMKQHDPGFSEFYSEWSIQHPTSQFAEATSICSSDISNVSDPTSSFVLDSSGNFPATLGPMTLGEVDLVCSNTPPSSENEDEVTWVVPESELNFHKMPCIQLPPKAASSGLSPATLGPLVLDEVHYEHINKQPPYGDEEAAVVVSDSALKSKTTPSIKLPQFLTPHIRLPPFLPSPLPLMTIFEVQNGNTMRSVQTMAIITSSWIVGAEISSTNGDCHRELEESQIRVQKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014130`
TK1151 ID	TkA03G104750
OH-1004 ID	LXL04_014130
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.300
Protein coverage (%)	TK1151 94.851 / OH-1004 45.515 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014130

Location Chr03:42435255-42437545 (+)

Description Similar to HSP83A: Heat shock protein 83

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52640`	Functions as a holding molecular chaperone (holdase) which stabilizes unfolding protein intermediates and rapidly releases them in an active form once stress has abated.	No verified direct reference in this release
`At5g56000`	Molecular chaperone which stabilizes unfolding protein intermediates and functions as a folding molecular chaperone that assists the non-covalent folding of proteins in an ATP-dependent manner.	No verified direct reference in this release
`At5g56030`	Molecular chaperone.	No verified direct reference in this release
`At5g56010`	Functions as a holding molecular chaperone (holdase) which stabilizes unfolding protein intermediates and rapidly releases them in an active form once stress has abated.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014130 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009908 flower development Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0010286 heat acclimation Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0046685 response to arsenic-containing substance Biological Process

KEGG gene cross-reference

ath:AT5G52640

ath:AT5G56000

ath:AT5G56010

ath:AT5G56030

ini:109146489

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.406

Rank 1 · LXL04_014130 · OH-1004

Nucleus0.341

Rank 2 · LXL04_014130 · OH-1004

Cell membrane0.156

Rank 3 · LXL04_014130 · OH-1004

Mitochondrion0.113

Rank 4 · LXL04_014130 · OH-1004

Endoplasmic reticulum0.084

Rank 5 · LXL04_014130 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P27323`	Arabidopsis thaliana	Heat shock protein 90-1	37.037%	Swiss-Prot	weak database homology
`O03986`	Arabidopsis thaliana	Heat shock protein 90-4	37.963%	Swiss-Prot	weak database homology
`P55737`	Arabidopsis thaliana	Heat shock protein 90-2	37.963%	Swiss-Prot	weak database homology
`P51818`	Arabidopsis thaliana	Heat shock protein 90-3	37.963%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card