TkA03G091510 | RubberDandelionOmics

Gene overview

TkA03G091510

Reference: TK1151 Chr: Chr03 Coordinates: 23295497-23297518 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1305 bp · TkA03G091510|TK1151|cDNA

ATGTTTTGGGCCGATGAGACTGCCAAGTTGAACTACAAAGAATTTGGTGATGTCGTATCATTTGATGCTACTTTTCGAACTAACAGATATCACATGGTATTTGTTCCTTTTACTGGCATCGACAACCATAAGAAGTCCGTTACTTTTGGTGCTGGTTTGCTTAGTCGCGAAGATATTGATTCATATACTTGGTTGTTGAAAGCGTTTTTGAATGCCTTTAAGAAACAACCGAAGTTGGTTTTATCACATCAAGATGCAGC...

CDS

Download CDS FASTA

1305 bp · TkA03G091510|TK1151|CDS

ATGTTTTGGGCCGATGAGACTGCCAAGTTGAACTACAAAGAATTTGGTGATGTCGTATCATTTGATGCTACTTTTCGAACTAACAGATATCACATGGTATTTGTTCCTTTTACTGGCATCGACAACCATAAGAAGTCCGTTACTTTTGGTGCTGGTTTGCTTAGTCGCGAAGATATTGATTCATATACTTGGTTGTTGAAAGCGTTTTTGAATGCCTTTAAGAAACAACCGAAGTTGGTTTTATCACATCAAGATGCAGC...

Protein

Download Protein FASTA

434 aa · TkA03G091510|TK1151|PROTEIN

MFWADETAKLNYKEFGDVVSFDATFRTNRYHMVFVPFTGIDNHKKSVTFGAGLLSREDIDSYTWLLKAFLNAFKKQPKLVLSHQDAAMKSAIACVLPESIHRLCMWHITSKLPLKVDSHILKNTNFKYDFSSIIWNSKIEEEEFEEGWDAVINKYNLTDNKWLSDMYDLRDSWIPAFFKYVPLSGLMRTTSRSESQNSAFHQNTHYGSTLVHFMISFEAAMEKQRFTQLSCDFKTSDKTPRMFNVSTCDNVEECLVKEFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G091510`
TK1151 ID	TkA03G091510
OH-1004 ID	LXL04_008667
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 62.673 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G091510

Location Chr03:23295497-23297518 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38180`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008667 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010018 far-red light signaling pathway Biological Process

GO:0010218 response to far red light Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G76320

ath:AT2G27110

ath:AT4G15090

ath:AT4G38170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.839

Rank 1 · TkA03G091510 · TK1151

Cytoplasm0.212

Rank 2 · TkA03G091510 · TK1151

Mitochondrion0.033

Rank 3 · TkA03G091510 · TK1151

Cell membrane0.025

Rank 4 · TkA03G091510 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA03G091510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21056ZSWIM1-3_RNaseH-like11-93 aa

PF10551MULE18-110 aa

PF00872Transposase_mut41-155 aa

PF10551MULE233-276 aa

PF16041APD1-4_M267-306 aa

PF04434SWIM299-318 aa

PF13248Zn_ribbon_3398-415 aa

PF25512zf-CCCH_AtC3H23402-415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G091510	`PF21056`	ZSWIM1-3_RNaseH-like	11	93	0.00018	22.1
TkA03G091510	`PF10551`	MULE	18	110	7.8e-26	91.0
TkA03G091510	`PF00872`	Transposase_mut	41	155	0.15	11.7
TkA03G091510	`PF10551`	MULE	233	276	7.8e-26	91.0
TkA03G091510	`PF16041`	APD1-4_M	267	306	0.047	14.6
TkA03G091510	`PF04434`	SWIM	299	318	0.023	14.9
TkA03G091510	`PF13248`	Zn_ribbon_3	398	415	0.86	9.9
TkA03G091510	`PF25512`	zf-CCCH_AtC3H23	402	415	1.7	9.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZL8`	Arabidopsis thaliana	sp\|Q9SZL8\|FRS5_ARATH Protein FAR1-RELATED SEQUENCE 5	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card