LXL04_008667 | RubberDandelionOmics

Gene overview

LXL04_008667

Reference: OH-1004 Chr: Chr02 Coordinates: 105582641-105583833 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · LXL04_008667|LXL04_008667|OH1004|cDNA

TTGTCAGATATGTACGATTTGAGAGAATCTTGGATTCCTGCATTTTTTAAGTATGTCCCATTATCCGGATTGATGAGAACCACATCGCGTTCTGAGAGTCAAAACTCCGCTTTCCATCAGAATACTCATTATGGGTCAACTCTTGTACATTTTATGATATCATTTGAAGCGGCGATGGAAAAGCAAAGATTTACCCAATTATCTTGTGATTTTAAAACAACTGACAAGACACCTAGGATGTTTAGTGTGAGTACTTGTGA...

CDS

Download CDS FASTA

819 bp · LXL04_008667|LXL04_008667|OH1004|CDS

TTGTCAGATATGTACGATTTGAGAGAATCTTGGATTCCTGCATTTTTTAAGTATGTCCCATTATCCGGATTGATGAGAACCACATCGCGTTCTGAGAGTCAAAACTCCGCTTTCCATCAGAATACTCATTATGGGTCAACTCTTGTACATTTTATGATATCATTTGAAGCGGCGATGGAAAAGCAAAGATTTACCCAATTATCTTGTGATTTTAAAACAACTGACAAGACACCTAGGATGTTTAGTGTGAGTACTTGTGA...

Protein

Download Protein FASTA

272 aa · LXL04_008667|LXL04_008667|OH1004|PROTEIN

MSDMYDLRESWIPAFFKYVPLSGLMRTTSRSESQNSAFHQNTHYGSTLVHFMISFEAAMEKQRFTQLSCDFKTTDKTPRMFSVSTCDNVDKCLVKEFRHVGDSTSKDYSVKLDDDNEEKWDVLLKESVYKITYDTKEETFKCSCMKFEQFGVLCRHNGIIPSIMLRKTFRYAGSNEGISITEKPDKNKEFEKRLGVTTPDVIEVENPAQVQTKGSGSRKRYKSTLEVSTQKGRKGTRCSYCRNSNEHDWRNCPDRKEDVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008667`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008667

Location Chr02:105582641-105583833 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76320`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At4g15090`	Transcription activator that recognizes and binds to the DNA consensus sequence 5'-CACGCGC-3'.	No verified direct reference in this release
`At2g27110`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At4g38170`	Putative transcription activator involved in regulating light control of development.	Arabidopsis FHY3/FAR1 gene family and distinct roles of its members in light control of Arabidopsis development.2004 · DOI: 10.1104/pp.104.052191

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008667 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010018 far-red light signaling pathway Biological Process

GO:0010218 response to far red light Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G76320

ath:AT2G27110

ath:AT4G15090

ath:AT4G38170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.889

Rank 1 · LXL04_008667 · OH-1004

Cytoplasm0.182

Rank 2 · LXL04_008667 · OH-1004

Mitochondrion0.032

Rank 3 · LXL04_008667 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_008667 · OH-1004

Extracellular0.012

Rank 5 · LXL04_008667 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQJ7`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 4	26.946%	Swiss-Prot	weak database homology
`Q9SWG3`	Arabidopsis thaliana	Protein FAR-RED IMPAIRED RESPONSE 1	26.901%	Swiss-Prot	weak database homology
`Q9ZVC9`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 3	24.000%	Swiss-Prot	weak database homology
`Q9SZL7`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 9	23.030%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card