TkA03G046860 | RubberDandelionOmics

Gene overview

TkA03G046860

Reference: TK1151 Chr: Chr03 Coordinates: 12364561-12367230 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

957 bp · TkA03G046860|TK1151|cDNA

ATGCCTGTGAAGCTTGAAGAGCTTATCGAACGACTTAATGGAATTGATGATGGTGAGAATGTTACGTGCATTGTGGCTGATATTTGTATGGGTTGGGCGTTTGAAGTTGCAGAGAAGATGAAGATAAGAAAAGCCGCCTTTTGGCCTGCAGCGGCTACAACATTAGTGTCGCTATTTTGCATCCCGAAGTTGCTTGAAGATGGAATCATAGATAACAAAGGGACTCCCATGAAGAAGCAAATGGTTCAATTATCACCGAC...

CDS

Download CDS FASTA

957 bp · TkA03G046860|TK1151|CDS

ATGCCTGTGAAGCTTGAAGAGCTTATCGAACGACTTAATGGAATTGATGATGGTGAGAATGTTACGTGCATTGTGGCTGATATTTGTATGGGTTGGGCGTTTGAAGTTGCAGAGAAGATGAAGATAAGAAAAGCCGCCTTTTGGCCTGCAGCGGCTACAACATTAGTGTCGCTATTTTGCATCCCGAAGTTGCTTGAAGATGGAATCATAGATAACAAAGGGACTCCCATGAAGAAGCAAATGGTTCAATTATCACCGAC...

Protein

Download Protein FASTA

318 aa · TkA03G046860|TK1151|PROTEIN

MPVKLEELIERLNGIDDGENVTCIVADICMGWAFEVAEKMKIRKAAFWPAAATTLVSLFCIPKLLEDGIIDNKGTPMKKQMVQLSPTIPSISSSEFTWLGIGDLNTQEILFNLMVKANEYVKLTDRTICNSAFELETEAWSVIYVAFGSFTLFDQRQFDELVLGLEMTNRPFLWVVREDMKNEGFINGTKSRGKIVGWAPQQKVLKHPSVGCFVTHCGWNSVLEGVSSGLPFICWPYFSDQFVNRMYICDVWKTGLEFDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G046860`
TK1151 ID	TkA03G046860
OH-1004 ID	LXL04_006541
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.500
Protein coverage (%)	TK1151 99.371 / OH-1004 75.847 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G046860

Location Chr03:12364561-12367230 (-)

Description Similar to UGT83A1: UDP-glycosyltransferase 83A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02100`	UDP-glycosyltransferase 83A1.	No verified direct reference in this release
`At3g21560`	Sinapate glucosyltransferase (SGT) required for the biosynthesis of the glucose ester sinapoylglucose and subsequently sinapoylmalate and sinapoylcholine.	Arabidopsis glucosyltransferases with activities toward both endogenous and xenobiotic substrates.2003 · DOI: 10.1007/s00425-002-0969-0 The hyper-fluorescent trichome phenotype of the brt1 mutant of Arabidopsis is the result of a defect in a sinapic acid: UDPG glucosyltransferase.2007 · DOI: 10.1111/j.1365-313x.2006.02984.x Two glycosyltransferases involved in anthocyanin modification delineated by transcriptome independent component analysis in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2011.04779.x Ectopic expression of UGT84A2 delayed flowering by indole-3-butyric acid-mediated transcriptional repression of ARF6 and ARF8 genes in Arabidopsis.2017 · DOI: 10.1007/s00299-017-2225-x
`At3g11340`	Glycosylates the amino acid-related molecules isoleucic acid (2-hydroxy-3-methylpentanoic acid) and valic acid (2-hydroxy-3- methylbutyric acid).	The Arabidopsis glucosyltransferase UGT76B1 conjugates isoleucic acid and modulates plant defense and senescence.2011 · DOI: 10.1105/tpc.111.088443

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006541 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050057 linamarin synthase activity Molecular Function

GO:0050403 trans-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0050502 cis-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AEO45781

ag:AEO45782

ath:AT1G22360

ath:AT1G22400

ath:AT3G02100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.695

Rank 1 · TkA03G046860 · TK1151

Nucleus0.164

Rank 2 · TkA03G046860 · TK1151

Peroxisome0.106

Rank 3 · TkA03G046860 · TK1151

Endoplasmic reticulum0.078

Rank 4 · TkA03G046860 · TK1151

Plastid0.059

Rank 5 · TkA03G046860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT141-291 aa

PF06722EryCIII-like_C195-296 aa

PF04101Glyco_tran_28_C214-284 aa

PF13405EF-hand_6257-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G046860	`PF00201`	UDPGT	141	291	1e-22	81.4
TkA03G046860	`PF06722`	EryCIII-like_C	195	296	0.0018	19.0
TkA03G046860	`PF04101`	Glyco_tran_28_C	214	284	0.26	12.0
TkA03G046860	`PF13405`	EF-hand_6	257	273	0.096	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGA8`	Arabidopsis thaliana	sp\|Q9SGA8\|U83A1_ARATH UDP-glycosyltransferase 83A1	40.800%	Swiss-Prot	Medium
`Q9LVF0`	Arabidopsis thaliana	sp\|Q9LVF0\|U84A2_ARATH UDP-glycosyltransferase 84A2	39.700%	Swiss-Prot	Medium
`Q9C768`	Arabidopsis thaliana	sp\|Q9C768\|U76B1_ARATH UDP-glycosyltransferase 76B1	42.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card