LXL04_006541 | RubberDandelionOmics

Gene overview

LXL04_006541

Reference: OH-1004 Chr: Chr02 Coordinates: 13123371-13125936 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1419 bp · LXL04_006541|LXL04_006541|OH1004|cDNA

ATGGGAAAACCACATGCTCTACTTGTACCTTATGCAGCACAAGGTCATGTAATCCCCATGATGGAACTTATGCAAAGACTAGTCAACCATGGTGTAAAAGTCACGTTTCTTAATACCGATTTCACTCACAAATTGGTCACTAATGCATCCTCAAATGATGAAAACTTGAACGATTTAGCAAGTTTTGTGTCACTTCCGGATGGTGTGGAAGATGAAGAGGACAGAAAGGATGTGGGAAAGGTAGCTGAATCGATCTATCA...

CDS

Download CDS FASTA

1419 bp · LXL04_006541|LXL04_006541|OH1004|CDS

ATGGGAAAACCACATGCTCTACTTGTACCTTATGCAGCACAAGGTCATGTAATCCCCATGATGGAACTTATGCAAAGACTAGTCAACCATGGTGTAAAAGTCACGTTTCTTAATACCGATTTCACTCACAAATTGGTCACTAATGCATCCTCAAATGATGAAAACTTGAACGATTTAGCAAGTTTTGTGTCACTTCCGGATGGTGTGGAAGATGAAGAGGACAGAAAGGATGTGGGAAAGGTAGCTGAATCGATCTATCA...

Protein

Download Protein FASTA

472 aa · LXL04_006541|LXL04_006541|OH1004|PROTEIN

MGKPHALLVPYAAQGHVIPMMELMQRLVNHGVKVTFLNTDFTHKLVTNASSNDENLNDLASFVSLPDGVEDEEDRKDVGKVAESIYQVMPKKLEELIERLNGNDNGEKVTCVVADTCMGWVFEVADKMKIRSAGFWTASAVGLATLWSVPKFLEDGIIDNKGTLVKKQMVQLSPSMPAISSEDFMWVRFGDIPMQEIAFDFTVKTNEFVKLADRVICNSSYELEPATFTSFPKILPIGPLLASNRVANQIGHFWKEDSTC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006541`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006541

Location Chr02:13123371-13125936 (+)

Description Similar to UGT83A1: UDP-glycosyltransferase 83A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02100`	UDP-glycosyltransferase 83A1.	No verified direct reference in this release
`At1g22400`	Involved in the O-glucosylation of trans-zeatin and dihydrozeatin.	N-glucosylation of cytokinins by glycosyltransferases of Arabidopsis thaliana.2004 · DOI: 10.1074/jbc.m409569200
`At1g22360`	UDP-glycosyltransferase 85A2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006541 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050057 linamarin synthase activity Molecular Function

GO:0050403 trans-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0050502 cis-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AEO45781

ag:AEO45782

ath:AT1G22360

ath:AT1G22400

ath:AT3G02100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.643

Rank 1 · LXL04_006541 · OH-1004

Nucleus0.151

Rank 2 · LXL04_006541 · OH-1004

Endoplasmic reticulum0.118

Rank 3 · LXL04_006541 · OH-1004

Plastid0.073

Rank 4 · LXL04_006541 · OH-1004

Peroxisome0.068

Rank 5 · LXL04_006541 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT8-421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006541	`PF00201.25`	UDPGT	8	421	3.5e-24	86.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGA8`	Arabidopsis thaliana	UDP-glycosyltransferase 83A1	42.763%	Swiss-Prot	moderate database homology
`Q9SK82`	Arabidopsis thaliana	UDP-glycosyltransferase 85A1	33.108%	Swiss-Prot	moderate database homology
`Q9ZWJ3`	Arabidopsis thaliana	UDP-glycosyltransferase 85A2	30.417%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card