TkA03G046600 | RubberDandelionOmics

Gene overview

TkA03G046600

Reference: TK1151 Chr: Chr03 Coordinates: 12287199-12294155 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4007 bp · TkA03G046600|TK1151|cDNA

CGGTCGGATGTGGGGTGATTAATTTGACTATTTGTGTGAATACCTTTCACAAAAAAAATTGAAAAAAAAGACTGTTACCACACCCATTCGAATTTTTTATTTATTGCCTTTTTGACATTTTGGATAGGGAGACACCGAGAGACCAAGACCTCGTCTTCCATCCTCACAGATCCAACTCCAAGTTCCAGTTCTTCCTCCAGTATTATGGCTTCTCCTGGTGCTTATGCTAGCTGCTATGACGTCTTTCTAAGCTTTAGAGG...

CDS

Download CDS FASTA

2352 bp · TkA03G046600|TK1151|CDS

ATGCATCGATTGCTTCAGGAGATAGGAAAAAGCATTGTTCGTCAAGAAGCATTAAAATTCCCCGAAAAACGTAGTAGAGTTTGGCTTAGTAGTGACTCTTATAAGATATTGAGCAAAGGAGAGGGTTCTGAAACAGTGGAGGGTCTAGCACTTGACATGGAAATGTTAAGGAAAGAGAAATTTTCGCTCAAGTCGTCAAACCTGAAGACGGATGCACTTCAAAATATGGATAAACTAAAATTGCTCCACCTAAATCGTGT...

Protein

Download Protein FASTA

783 aa · TkA03G046600|TK1151|PROTEIN

MHRLLQEIGKSIVRQEALKFPEKRSRVWLSSDSYKILSKGEGSETVEGLALDMEMLRKEKFSLKSSNLKTDALQNMDKLKLLHLNRVSFDGSYENFSEDLIWLCWTGFHLKSIPSELSMRKLVAIDMSYSRLEVFEPPMDLQSLQILNLKDSHYLTEIRNISRIPNLETLILWNCYSLVRVCDTIRDLTCLTLLNMTGCENLCNKVQRNLLVGIEASPSRGGVVAGPPTFSFPHSLHRLSLKDCNFQSTDSFPLSFSAQV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G046600`
TK1151 ID	TkA03G046600
OH-1004 ID	LXL04_006538
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 98.340 / OH-1004 61.244 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G046600`
Location	Chr03:12287199-12294155 (-)
Description	Similar to RUN1: Disease resistance protein RUN1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006538` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0007165 signal transduction Biological Process GO:0019677 NAD+ catabolic process Biological Process GO:0043068 positive regulation of programmed cell death Biological Process GO:0050832 defense response to fungus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003953 NAD+ nucleosidase activity Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0043531 ADP binding Molecular Function GO:0050135 NADP+ nucleosidase activity Molecular Function GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.461

Rank 1 · TkA03G046600 · TK1151

Cytoplasm0.391

Rank 2 · TkA03G046600 · TK1151

Cell membrane0.229

Rank 3 · TkA03G046600 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA03G046600 · TK1151

Plastid0.039

Rank 5 · TkA03G046600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23282WHD_ROQ11-15 aa

PF12799LRR_461-86 aa

PF13855LRR_867-85 aa

PF25019LRR_R13L1-DRL2170-84 aa

PF25013LRR_Zer-171-85 aa

PF23211LRR_LRWD1119-186 aa

PF12799LRR_4125-160 aa

PF25019LRR_R13L1-DRL21132-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G046600	`PF23282`	WHD_ROQ1	1	15	0.11	13.4
TkA03G046600	`PF12799`	LRR_4	61	86	9.5e-06	26.4
TkA03G046600	`PF13855`	LRR_8	67	85	0.00012	22.4
TkA03G046600	`PF25019`	LRR_R13L1-DRL21	70	84	0.0085	16.7
TkA03G046600	`PF25013`	LRR_Zer-1	71	85	0.00011	23.1
TkA03G046600	`PF23211`	LRR_LRWD1	119	186	0.06	13.8
TkA03G046600	`PF12799`	LRR_4	125	160	9.5e-06	26.4
TkA03G046600	`PF25019`	LRR_R13L1-DRL21	132	198	0.0085	16.7
TkA03G046600	`PF13855`	LRR_8	139	172	0.00012	22.4
TkA03G046600	`PF23598`	LRR_14	139	203	1.5	8.3
TkA03G046600	`PF25013`	LRR_Zer-1	140	199	0.00011	23.1
TkA03G046600	`PF13855`	LRR_8	143	199	0.00012	22.4
TkA03G046600	`PF23286`	LRR_13	164	202	0.093	13.1
TkA03G046600	`PF12799`	LRR_4	165	200	9.5e-06	26.4
TkA03G046600	`PF23598`	LRR_14	229	318	1.5	8.3
TkA03G046600	`PF25019`	LRR_R13L1-DRL21	234	290	0.0085	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card