TkA03G026920 | RubberDandelionOmics

Gene overview

TkA03G026920

Reference: TK1151 Chr: Chr03 Coordinates: 7244811-7245488 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkA03G026920|TK1151|cDNA

ATGAACAATTCGACCCCAATTCTTCGTAAACTCAATTCACAGTTTATCGGAATGCGTAAAGGACTCGGCTTTTGCAGACCCACTTCAAGAATCGGACCGAGTAGTTGCAATGCAAGAACAACCTGTTGGTTCAAATTCGGTAAAAATGGCGTCGATGCTAAAGGTGCTGGTATTTACGGCAGTCAATCTCGTGACGATTTTGACCGGGACGATGTAGAGAAGGTACCCCTTTTTTATTTGAATCTTTTTGGTCTTCTTGA...

CDS

Download CDS FASTA

381 bp · TkA03G026920|TK1151|CDS

ATGAACAATTCGACCCCAATTCTTCGTAAACTCAATTCACAGTTTATCGGAATGCGTAAAGGACTCGGCTTTTGCAGACCCACTTCAAGAATCGGACCGAGTAGTTGCAATGCAAGAACAACCTGTTGGTTCAAATTCGGTAAAAATGGCGTCGATGCTAAAGGTGCTGGTATTTACGGCAGTCAATCTCGTGACGATTTTGACCGGGACGATGTAGAGAAGGTACCCCTTTTTTATTTGAATCTTTTTGGTCTTCTTGA...

Protein

Download Protein FASTA

126 aa · TkA03G026920|TK1151|PROTEIN

MNNSTPILRKLNSQFIGMRKGLGFCRPTSRIGPSSCNARTTCWFKFGKNGVDAKGAGIYGSQSRDDFDRDDVEKVPLFYLNLFGLLDSTQVSNQNKSESGDEGTEESGDEGIADRLQIRTNRNPFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G026920`
TK1151 ID	TkA03G026920
OH-1004 ID	LXL04_030948
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.900
Protein coverage (%)	TK1151 68.254 / OH-1004 9.436 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G026920

Location Chr03:7244811-7245488 (-)

Description Similar to TOR1: Microtubule-associated protein TORTIFOLIA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50900`	Involved in the import of light-harvesting complex proteins (LHCP) and subsequent routing of these proteins to the chloroplast signal recognition particle (SRP) pathway.	The GDC1 gene encodes a novel ankyrin domain-containing protein that is essential for grana formation in Arabidopsis.2011 · DOI: 10.1104/pp.110.165589

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YLX7`	Involved in the import of light-harvesting complex proteins (LHCP) and subsequent routing of these proteins to the chloroplast signal recognition particle (SRP) pathway.	No verified direct reference in this release
`Os07g0520800`	Involved in the import of light-harvesting complex proteins (LHCP) and subsequent routing of these proteins to the chloroplast signal recognition particle (SRP) pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030948 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010031 circumnutation Biological Process

GO:0090391 granum assembly Biological Process

GO:0170002 halotropism Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010005 cortical microtubule, transverse to long axis Cellular Component

GO:0055028 cortical microtubule Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G50890

ath:AT1G50900

ath:AT4G27060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.968

Rank 1 · TkA03G026920 · TK1151

Mitochondrion0.033

Rank 2 · TkA03G026920 · TK1151

Nucleus0.029

Rank 3 · TkA03G026920 · TK1151

Cytoplasm0.017

Rank 4 · TkA03G026920 · TK1151

Cell membrane0.011

Rank 5 · TkA03G026920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY88`	Arabidopsis thaliana	sp\|Q8VY88\|LTD_ARATH Protein LHCP TRANSLOCATION DEFECT	60.700%	Swiss-Prot	Medium
`A2YLX7`	Oryza sativa subsp. indica	sp\|A2YLX7\|LTD_ORYSI Protein LHCP TRANSLOCATION DEFECT	55.100%	Swiss-Prot	Medium
`A3BKF2`	Oryza sativa subsp. japonica	sp\|A3BKF2\|LTD_ORYSJ Protein LHCP TRANSLOCATION DEFECT	55.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card