TkA03G026750 | RubberDandelionOmics

Gene overview

TkA03G026750

Reference: TK1151 Chr: Chr03 Coordinates: 7167164-7185121 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2598 bp · TkA03G026750|TK1151|cDNA

TATGCTATACTTTATGATATAATACGAAATCTCTTTGCAAAGATTGAATTCCCTTATAAAAAAAGGCGGGTACTCCCATTTCAGGTAGGTTAACATAAAGATCTTCCTTTACTTCCCAATCTGTGTATCTGTCGCCGGCGGGAAATCATCTTTGATTCAGACTTTCTGGGCCTATTAAGGCCGTAATTCTGGAAGGATGATTCTTTCTGCTCTTTTGACATCCGTTGGAATAAACTTCGGTTTATGTATTATATACATCA...

CDS

Download CDS FASTA

1236 bp · TkA03G026750|TK1151|CDS

ATGTATGCCTTCACTGCATTTGTGTACTATCTTCTGTATGATGAGTATAGTTATATATCTTCGAAAAGGCTTGCATTCTACTCCTCATCCGAGCCTAAGTTCAACGAATTTACAGTATTGGTTCGAGGTATCCCAAAGTCATCCACCCAAAGCTTAAATGAAACTGTTGAGAAATTTTTCTCAGAGTGTTATCCTTCGTCATATCTATCACATTATATGGTCTATAACACTTCAAAGATTTGGAAGCTAATTCTTGATGC...

Protein

Download Protein FASTA

411 aa · TkA03G026750|TK1151|PROTEIN

MYAFTAFVYYLLYDEYSYISSKRLAFYSSSEPKFNEFTVLVRGIPKSSTQSLNETVEKFFSECYPSSYLSHYMVYNTSKIWKLILDAKEIYERLSNLKSTKKRSQRYGRVGFFGLCGPKVDLVEYYEKELEDLEDKVRMEQTLLNGKEHRAAFVSFKSRIGAAVTLHIQQGPNPTEWLTEQAPEDRDIYWAFFSTSFLTRWIGNVVVVIACVILTILFFIPVVIVQGLTNLYTLEAWFPFLKGILDINIISQVITGYLPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G026750`
TK1151 ID	TkA03G026750
OH-1004 ID	LXL04_006325
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.268 / OH-1004 55.045 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G026750

Location Chr03:7167164-7185121 (+)

Description Similar to HYP1: CSC1-like protein HYP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01100`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g69450`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g62320`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g11960`	Calcium-permeable channel that plays a key role in plant stomatal immunity.	The calcium-permeable channel OSCA1.3 regulates plant stomatal immunity.2020 · DOI: 10.1038/s41586-020-2702-1
`At1g58520`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006325 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007231 osmosensory signaling pathway Biological Process

GO:0010118 stomatal movement Biological Process

GO:0045087 innate immune response Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005227 calcium-activated cation channel activity Molecular Function

GO:0005262 calcium channel activity Molecular Function

GO:0008381 mechanosensitive monoatomic ion channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G10090

ath:AT1G11960

ath:AT1G58520

ath:AT1G69450

ath:AT3G01100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.512

Rank 1 · TkA03G026750 · TK1151

Endoplasmic reticulum0.192

Rank 2 · TkA03G026750 · TK1151

Cytoplasm0.155

Rank 3 · TkA03G026750 · TK1151

Lysosome / Vacuole0.147

Rank 4 · TkA03G026750 · TK1151

Golgi apparatus0.090

Rank 5 · TkA03G026750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14703PHM7_cyt37-191 aa

PF24825SNU71_RBD37-112 aa

PF27598AKAP9_coil_N87-183 aa

PF02714RSN1_7TM205-373 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G026750	`PF14703`	PHM7_cyt	37	191	1.3e-38	133.7
TkA03G026750	`PF24825`	SNU71_RBD	37	112	0.1	13.8
TkA03G026750	`PF27598`	AKAP9_coil_N	87	183	0.26	10.8
TkA03G026750	`PF02714`	RSN1_7TM	205	373	6.1e-42	144.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUH7`	Arabidopsis thaliana	sp\|Q8GUH7\|OSC23_ARATH Hyperosmolality-gated Ca2+ permeable channel 2.3	57.000%	Swiss-Prot	High
`F4I248`	Arabidopsis thaliana	sp\|F4I248\|OSC24_ARATH Hyperosmolality-gated Ca2+ permeable channel 2.4	51.700%	Swiss-Prot	High
`F4HYR3`	Arabidopsis thaliana	sp\|F4HYR3\|OSC14_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.4	38.100%	Swiss-Prot	Medium
`B5TYT3`	Arabidopsis thaliana	sp\|B5TYT3\|OSC13_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.3	37.100%	Swiss-Prot	Medium
`F4IBD7`	Arabidopsis thaliana	sp\|F4IBD7\|OSC21_ARATH Hyperosmolality-gated Ca2+ permeable channel 2.1	41.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card