TkA03G024880 | RubberDandelionOmics

Gene overview

TkA03G024880

Reference: TK1151 Chr: Chr03 Coordinates: 6412573-6414572 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1047 bp · TkA03G024880|TK1151|cDNA

ATGAACCATGAAGTCATATTACCAGGTTTCAGATTTCATCCAACAGATGAAGAACTTGTTGGATTCTATCTAAAGAAAAAGATTGAACATCGGATTCTTCCAATCGAGCTTATCAAACAAGTCGATATTTACAAATACGATCCCTGGGATCTTCCAAATTTAGCTCCATCAGGAGAAAAAGAATGGTATTTTTATTGTCCAAGGGATCGGAAATACAAGAATAGTGCACGACCGAATCGGGTTACAGGAGCCGGTTTTTG...

CDS

Download CDS FASTA

1047 bp · TkA03G024880|TK1151|CDS

ATGAACCATGAAGTCATATTACCAGGTTTCAGATTTCATCCAACAGATGAAGAACTTGTTGGATTCTATCTAAAGAAAAAGATTGAACATCGGATTCTTCCAATCGAGCTTATCAAACAAGTCGATATTTACAAATACGATCCCTGGGATCTTCCAAATTTAGCTCCATCAGGAGAAAAAGAATGGTATTTTTATTGTCCAAGGGATCGGAAATACAAGAATAGTGCACGACCGAATCGGGTTACAGGAGCCGGTTTTTG...

Protein

Download Protein FASTA

348 aa · TkA03G024880|TK1151|PROTEIN

MNHEVILPGFRFHPTDEELVGFYLKKKIEHRILPIELIKQVDIYKYDPWDLPNLAPSGEKEWYFYCPRDRKYKNSARPNRVTGAGFWKATGTDRPIYSSSGATCIGLKKSLVFYRGRAAKGIKTDWMMHEFRLPSVIEPESDKKIHDKNLPMNEAWAICRIFKKTNSIAQRVISHSWASSLNEDRTSEYFPHSHQFSPNNISSMNDHLSYTIKPASIDGFSGLETPLHRPINPTATSKPSTSSLPYVDFTSGCMFSSTDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G024880`
TK1151 ID	TkA03G024880
OH-1004 ID	LXL04_021040
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	56.400
Protein coverage (%)	TK1151 73.563 / OH-1004 61.451 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G024880

Location Chr03:6412573-6414572 (+)

Description Similar to FEZ: Protein FEZ

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26870`	Promotes periclinal root capforming cell divisions.	No verified direct reference in this release
`At5g39820`	Putative NAC domain-containing protein 94.	No verified direct reference in this release
`At2g43000`	Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence.	JUNGBRUNNEN1, a reactive oxygen species-responsive NAC transcription factor, regulates longevity in Arabidopsis.2012 · DOI: 10.1105/tpc.111.090894
`At3g15510`	Transcription factor of the NAC family (Probable).	NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060160
`At1g52880`	May encode a transcription factor involved in the elaboration of shoot apical meristems (SAM) (Probable).	NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060160

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021040 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005992 trehalose biosynthetic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009908 flower development Biological Process

GO:0010120 camalexin biosynthetic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0045770 positive regulation of asymmetric cell division Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0048103 somatic stem cell division Biological Process

KEGG gene cross-reference

ath:AT1G26870

ath:AT2G02450

ath:AT2G43000

ath:AT3G15510

ath:AT5G39820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA03G024880 · TK1151

Cytoplasm0.091

Rank 2 · TkA03G024880 · TK1151

Cell membrane0.037

Rank 3 · TkA03G024880 · TK1151

Endoplasmic reticulum0.027

Rank 4 · TkA03G024880 · TK1151

Plastid0.015

Rank 5 · TkA03G024880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM8-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G024880	`PF02365`	NAM	8	133	3.7e-47	160.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVH0`	Arabidopsis thaliana	sp\|Q9ZVH0\|FEZ_ARATH Protein FEZ	60.600%	Swiss-Prot	High
`Q9FIW5`	Arabidopsis thaliana	sp\|Q9FIW5\|NAC94_ARATH Putative NAC domain-containing protein 94	70.700%	Swiss-Prot	Medium
`Q9SK55`	Arabidopsis thaliana	sp\|Q9SK55\|NAC42_ARATH Transcription factor JUNGBRUNNEN 1	61.800%	Swiss-Prot	Low
`Q9LD44`	Arabidopsis thaliana	sp\|Q9LD44\|NAC56_ARATH NAC transcription factor 56	53.700%	Swiss-Prot	Low
`Q9ZNU2`	Arabidopsis thaliana	sp\|Q9ZNU2\|NAC18_ARATH NAC domain-containing protein 18	53.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card