TkA03G021780 | RubberDandelionOmics

Gene overview

TkA03G021780

Reference: TK1151 Chr: Chr03 Coordinates: 5620562-5621715 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1054 bp · TkA03G021780|TK1151|cDNA

CAGAGGAAGAGCATCTAGCCCTCCTTTTGGACAAATACAAGAATAAGTTAACCACATTACCCAAACAGAAAGGGTGGATGGGTGAAACCTTTTACATGTATCAAGGCTTTTGGTATCGCTCCAGTAGCCCATTCTCAGTTCAGATGACAATGGCCATGCAAGACTCTTTCAAGCCTCATCCAACTGATATCTACTTACTCACACTACCAAAATCCGGCACAACGTGGGTCAAGGCCCTCATGTTTGCTACCGTGAACCGC...

CDS

Download CDS FASTA

567 bp · TkA03G021780|TK1151|CDS

ATGTGTGCCGTATATCGAGCAAGAATTTATCAAGAAAACACCTACTCATGTTCAAGAAAAGCCAAACCCATAAACCCGAAAGATGTTATGGTGTCTTGGTATTACTTTTCAAACAAGTTCCCTCACGAGATCCTAACCCCAATGACGATTAATGAGATGTTTGAGGTGTTTGTTAAAGGTATGGTGCCATATGGACCTTACTGGGACCACGTGAAAGAGTACTATAATGCCAGTTGTGAACATCCGACAAAGATTCTTTT...

Protein

Download Protein FASTA

188 aa · TkA03G021780|TK1151|PROTEIN

MCAVYRARIYQENTYSCSRKAKPINPKDVMVSWYYFSNKFPHEILTPMTINEMFEVFVKGMVPYGPYWDHVKEYYNASCEHPTKILFLTYEVMKKDTMNQVKRIAEFLGCPFSKEEEGNGGVDQIIKLCSLESLKEVNKDGEYGDGIPNAAFFREGKVGGWRNDLTDEMIKILDDITDEKFQDLDISF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G021780`
TK1151 ID	TkA03G021780
OH-1004 ID	LXL04_006265
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 87.234 / OH-1004 47.399 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G021780

Location Chr03:5620562-5621715 (+)

Description Similar to SOT5: Cytosolic sulfotransferase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45070`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to specifically catalyze the sulfate conjugation of flavones and flavonols.	Biochemical and molecular characterization of flavonoid 7-sulfotransferase from Arabidopsis thaliana.2006 · DOI: 10.1016/j.plaphy.2006.10.004
`At1g28170`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release
`At2g03760`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the stereospecific sulfate conjugation of 24-epibrassinosteroids.	Molecular and biochemical characterization of two brassinosteroid sulfotransferases from Arabidopsis, AtST4a (At2g14920) and AtST1 (At2g03760).2007 · DOI: 10.1007/s00425-006-0413-y A stress-inducible sulphotransferase sulphonates salicylic acid and confers pathogen resistance in Arabidopsis.2010 · DOI: 10.1111/j.1365-3040.2010.02156.x
`At5g43690`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release
`At3g45080`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006265 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009806 lignan metabolic process Biological Process

GO:0009812 flavonoid metabolic process Biological Process

GO:0016131 brassinosteroid metabolic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0032260 response to jasmonic acid stimulus involved in jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0051923 sulfation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G13420

ath:AT1G74100

ath:AT2G03760

ath:AT2G03770

ath:AT3G45070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.711

Rank 1 · TkA03G021780 · TK1151

Nucleus0.144

Rank 2 · TkA03G021780 · TK1151

Endoplasmic reticulum0.103

Rank 3 · TkA03G021780 · TK1151

Peroxisome0.099

Rank 4 · TkA03G021780 · TK1151

Golgi apparatus0.043

Rank 5 · TkA03G021780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00685Sulfotransfer_125-184 aa

PF11447DUF320131-84 aa

PF13469Sulfotransfer_368-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G021780	`PF00685`	Sulfotransfer_1	25	184	1.5e-41	143.2
TkA03G021780	`PF11447`	DUF3201	31	84	0.077	13.2
TkA03G021780	`PF13469`	Sulfotransfer_3	68	113	0.0091	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1V2`	Arabidopsis thaliana	sp\|Q9M1V2\|SOT5_ARATH Cytosolic sulfotransferase 5	45.500%	Swiss-Prot	Medium
`Q9FZ91`	Arabidopsis thaliana	sp\|Q9FZ91\|SOT7_ARATH Cytosolic sulfotransferase 7	46.400%	Swiss-Prot	Medium
`P52839`	Arabidopsis thaliana	sp\|P52839\|SOT12_ARATH Cytosolic sulfotransferase 12	45.200%	Swiss-Prot	Medium
`Q9FG94`	Arabidopsis thaliana	sp\|Q9FG94\|SOT1_ARATH Cytosolic sulfotransferase 1	43.400%	Swiss-Prot	Medium
`Q9M1V1`	Arabidopsis thaliana	sp\|Q9M1V1\|SOT6_ARATH Cytosolic sulfotransferase 6	44.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card