TkA03G012290 | RubberDandelionOmics

Gene overview

TkA03G012290

Reference: TK1151 Chr: Chr03 Coordinates: 3192961-3193629 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · TkA03G012290|TK1151|cDNA

ATGGGGAGCGTTAACAAAGAAGGTTCGATGAAGAAGATAGCGTTAGGGTTTAGGATATTCGAATTGCTATTCTGTTTAGTATCGTTGTCGGTGATGGCGACCGACAAAAACCAGGGATGGGCTTTCGACTCGTTCTACCGCTACAAGGAGTTCCGGTACTCCATGGCAGTGAACATCGTCGGATTCGCATACGCCGTCCTACAAGGACTTGATCTAGCGTATCAGTTAGCCACCGGAAATCATTACAAAAAACGCCACTA...

CDS

Download CDS FASTA

489 bp · TkA03G012290|TK1151|CDS

ATGGGGAGCGTTAACAAAGAAGGTTCGATGAAGAAGATAGCGTTAGGGTTTAGGATATTCGAATTGCTATTCTGTTTAGTATCGTTGTCGGTGATGGCGACCGACAAAAACCAGGGATGGGCTTTCGACTCGTTCTACCGCTACAAGGAGTTCCGGTACTCCATGGCAGTGAACATCGTCGGATTCGCATACGCCGTCCTACAAGGACTTGATCTAGCGTATCAGTTAGCCACCGGAAATCATTACAAAAAACGCCACTA...

Protein

Download Protein FASTA

162 aa · TkA03G012290|TK1151|PROTEIN

MGSVNKEGSMKKIALGFRIFELLFCLVSLSVMATDKNQGWAFDSFYRYKEFRYSMAVNIVGFAYAVLQGLDLAYQLATGNHYKKRHYLRYYFDFAMDQMLTYLLISSGSSAATRVDDWKSNWGADKFPQLATTSVGLGFVAFVAFAFSSLISGYLLYASTSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G012290`
TK1151 ID	TkA03G012290
OH-1004 ID	LXL04_006151
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 48.071 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G012290

Location Chr03:3192961-3193629 (-)

Description Similar to At5g40300: CASP-like protein 4A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40300`	CASP-like protein 4A1.	No verified direct reference in this release
`At2g36330`	CASP-like protein 4A3.	No verified direct reference in this release
`At5g62820`	CASP-like protein 4A2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006151 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

aly:9300896

ath:AT2G36330

ath:AT5G40300

ath:AT5G62820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.813

Rank 1 · TkA03G012290 · TK1151

Endoplasmic reticulum0.089

Rank 2 · TkA03G012290 · TK1151

Cytoplasm0.086

Rank 3 · TkA03G012290 · TK1151

Lysosome / Vacuole0.058

Rank 4 · TkA03G012290 · TK1151

Nucleus0.033

Rank 5 · TkA03G012290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04535CASP_dom9-144 aa

PF01284MARVEL14-149 aa

PF24403iSirtuin20-42 aa

PF24403iSirtuin103-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G012290	`PF04535`	CASP_dom	9	144	8.8e-30	104.2
TkA03G012290	`PF01284`	MARVEL	14	149	1e-06	29.5
TkA03G012290	`PF24403`	iSirtuin	20	42	0.3	11.2
TkA03G012290	`PF24403`	iSirtuin	103	136	0.3	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNE8`	Arabidopsis thaliana	sp\|Q9FNE8\|CSPLV_ARATH CASP-like protein 4A1	55.700%	Swiss-Prot	High
`Q84WP5`	Arabidopsis thaliana	sp\|Q84WP5\|CSPL8_ARATH CASP-like protein 4A3	52.000%	Swiss-Prot	High
`Q501G6`	Arabidopsis thaliana	sp\|Q501G6\|CSPLY_ARATH CASP-like protein 4A2	51.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card