TkA03G007190 | RubberDandelionOmics

Gene overview

TkA03G007190

Reference: TK1151 Chr: Chr03 Coordinates: 1723851-1727447 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2952 bp · TkA03G007190|TK1151|cDNA

TTTGGATAAATGGATAATGAAAAACATCCTTGTAACTGTCCAATGAAACGTGTCACTTCCGACAAGAACATGATTGATTCCACATCTCCAATTTCATATCTTTCTCCAAACAAAACCAACCTCTTATTCCTTTCTCTACTTCCATGGCAGCAGCTTTCCACTAAATGCTTTTGCAGTCTTTTCTTCTTTGTCTTCAACTACCCCCATTACTCATACCTCTCTCGTTTCTTGCTTTTATTACTTTCAACACCCATTTCTCC...

CDS

Download CDS FASTA

2271 bp · TkA03G007190|TK1151|CDS

ATGGTGTATTACTTGTTTCACATACTCTTCATTTCATGGGGTCTCATGATCTCAAACACACATTCATTAGAAGCCACTCAAATTCAACTTCTTCTCCAATTACGAAAGCATTTGGAGTACCCAATTCAGTTAAACAATTGGGAAAACTACACGGGTGATTTTTGTTACGTTCCTTCAACTCTTCATGTCACTATTAAATGTGAAAACAATTCTCTTAGTAAGCTTAAAATCATGGGAGATAAAGATAAGTTTCAAAATAT...

Protein

Download Protein FASTA

756 aa · TkA03G007190|TK1151|PROTEIN

MVYYLFHILFISWGLMISNTHSLEATQIQLLLQLRKHLEYPIQLNNWENYTGDFCYVPSTLHVTIKCENNSLSKLKIMGDKDKFQNITLFNGFAIQNQTLSDSFSIDSFVVTLVRLSTLKVLSLVSLGIWGRLPDKIHRLHSLEVLDMSSNFMFGGVPNEITRLKKLRTLTLDGNFFNESIPDWFDSLSNLTILSLKNNKLTGSFPSSITKITTITDLSLSHNQLSGKLPDLSTLSNLRLLDLRENHLDSELPLLPKGVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G007190`
TK1151 ID	TkA03G007190
OH-1004 ID	LXL04_006053
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G007190

Location Chr03:1723851-1727447 (-)

Description Similar to At3g03770: Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03770`	Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770.	No verified direct reference in this release
`At1g14390`	Probable LRR receptor-like serine/threonine-protein kinase At1g14390.	No verified direct reference in this release
`At2g02780`	Probable LRR receptor-like serine/threonine-protein kinase At2g02780.	No verified direct reference in this release
`At5g61350`	Probable receptor-like protein kinase At5g61350.	No verified direct reference in this release
`At2g21480`	Probable receptor-like protein kinase At2g21480.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006053 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009556 microsporogenesis Biological Process

GO:0010234 anther wall tapetum cell fate specification Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019199 transmembrane receptor protein kinase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14390

ath:AT3G03770

ath:AT5G07280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.837

Rank 1 · TkA03G007190 · TK1151

Endoplasmic reticulum0.079

Rank 2 · TkA03G007190 · TK1151

Cytoplasm0.065

Rank 3 · TkA03G007190 · TK1151

Nucleus0.049

Rank 4 · TkA03G007190 · TK1151

Lysosome / Vacuole0.036

Rank 5 · TkA03G007190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24542Ig_TPPC8_C53-70 aa

PF23211LRR_LRWD161-89 aa

PF12799LRR_467-76 aa

PF24542Ig_TPPC8_C98-172 aa

PF23598LRR_14112-219 aa

PF25013LRR_Zer-1114-151 aa

PF25019LRR_R13L1-DRL21115-149 aa

PF13855LRR_8118-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G007190	`PF24542`	Ig_TPPC8_C	53	70	0.11	13.1
TkA03G007190	`PF23211`	LRR_LRWD1	61	89	0.048	14.1
TkA03G007190	`PF12799`	LRR_4	67	76	2e-13	50.8
TkA03G007190	`PF24542`	Ig_TPPC8_C	98	172	0.11	13.1
TkA03G007190	`PF23598`	LRR_14	112	219	5.1e-14	52.5
TkA03G007190	`PF25013`	LRR_Zer-1	114	151	0.024	15.5
TkA03G007190	`PF25019`	LRR_R13L1-DRL21	115	149	0.0014	19.2
TkA03G007190	`PF13855`	LRR_8	118	175	4.1e-19	68.8
TkA03G007190	`PF12799`	LRR_4	118	151	2e-13	50.8
TkA03G007190	`PF00560`	LRR_1	119	139	1.2e-19	66.9
TkA03G007190	`PF24758`	LRR_At5g56370	122	175	0.02	15.2
TkA03G007190	`PF23211`	LRR_LRWD1	139	223	0.048	14.1
TkA03G007190	`PF13516`	LRR_6	141	151	2.6	9.0
TkA03G007190	`PF00560`	LRR_1	142	164	1.2e-19	66.9
TkA03G007190	`PF12799`	LRR_4	142	183	2e-13	50.8
TkA03G007190	`PF23598`	LRR_14	157	249	5.1e-14	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFN2`	Arabidopsis thaliana	sp\|Q8LFN2\|Y3037_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770	48.700%	Swiss-Prot	Medium
`Q9M9S4`	Arabidopsis thaliana	sp\|Q9M9S4\|Y1143_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g14390	35.500%	Swiss-Prot	Medium
`C0LGJ9`	Arabidopsis thaliana	sp\|C0LGJ9\|Y2278_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g02780	38.700%	Swiss-Prot	Low
`Q9FLJ8`	Arabidopsis thaliana	sp\|Q9FLJ8\|Y5613_ARATH Probable receptor-like protein kinase At5g61350	37.200%	Swiss-Prot	Low
`Q9SJT0`	Arabidopsis thaliana	sp\|Q9SJT0\|Y2214_ARATH Probable receptor-like protein kinase At2g21480	38.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card