LXL04_006053 | RubberDandelionOmics

Gene overview

LXL04_006053

Reference: OH-1004 Chr: Chr02 Coordinates: 1149305-1152221 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2271 bp · LXL04_006053|LXL04_006053|OH1004|cDNA

ATGGTGTATTACTTGTTTCACATACTCTTCATTTCATGGGGTCTTATGATCTCAAACACACATTCATTAGAAGCCACTCAATTTCAACTTCTTCTCCAATTACGAAAGCATTTGGAGTACCCAATTCAGTTAAACAATTGGGAAAACTACACGGGTGATTTTTGTTACGTTCCTTCAACTCTTCATGTCACTATTAAATGTGAAAACAATTCTCTTAGTGAGCTTAAAATTATGGGAGATAAAGATAAGTTTCAAAATAT...

CDS

Download CDS FASTA

2271 bp · LXL04_006053|LXL04_006053|OH1004|CDS

ATGGTGTATTACTTGTTTCACATACTCTTCATTTCATGGGGTCTTATGATCTCAAACACACATTCATTAGAAGCCACTCAATTTCAACTTCTTCTCCAATTACGAAAGCATTTGGAGTACCCAATTCAGTTAAACAATTGGGAAAACTACACGGGTGATTTTTGTTACGTTCCTTCAACTCTTCATGTCACTATTAAATGTGAAAACAATTCTCTTAGTGAGCTTAAAATTATGGGAGATAAAGATAAGTTTCAAAATAT...

Protein

Download Protein FASTA

756 aa · LXL04_006053|LXL04_006053|OH1004|PROTEIN

MVYYLFHILFISWGLMISNTHSLEATQFQLLLQLRKHLEYPIQLNNWENYTGDFCYVPSTLHVTIKCENNSLSELKIMGDKDKFQNITLFNGFAIQNQTLSDSFSIDSFVVTLVRLSTLKVLSLVSLGIWGRLPDKIHRLHSLEVLDMSSNFMFGGVPNEISRLKKLRTLTLDGNFFNESIPDWFDSLSNLTILSLKNNKLTGSFPSSITKITTITDLSLSHNQLSGKLPDLSTLSNLRLLDLRENHLDSELPLLPKGVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006053`
TK1151 ID	TkA03G007190
OH-1004 ID	LXL04_006053
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006053

Location Chr02:1149305-1152221 (-)

Description Similar to At3g03770: Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03770`	Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770.	No verified direct reference in this release
`At1g14390`	Probable LRR receptor-like serine/threonine-protein kinase At1g14390.	No verified direct reference in this release
`At5g07280`	Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities.	No verified direct reference in this release
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At5g44700`	Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006053 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009556 microsporogenesis Biological Process

GO:0010234 anther wall tapetum cell fate specification Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019199 transmembrane receptor protein kinase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14390

ath:AT3G03770

ath:AT5G07280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.834

Rank 1 · LXL04_006053 · OH-1004

Endoplasmic reticulum0.079

Rank 2 · LXL04_006053 · OH-1004

Cytoplasm0.066

Rank 3 · LXL04_006053 · OH-1004

Nucleus0.049

Rank 4 · LXL04_006053 · OH-1004

Lysosome / Vacuole0.038

Rank 5 · LXL04_006053 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14113-199 aa

PF13855.13LRR_8118-175 aa

PF23598.2LRR_14157-250 aa

PF13855.13LRR_8182-225 aa

PF00069.32Pkinase473-634 aa

PF07714.24PK_Tyr_Ser-Thr475-734 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006053	`PF23598.2`	LRR_14	113	199	8e-14	51.9
LXL04_006053	`PF13855.13`	LRR_8	118	175	4.8e-20	71.8
LXL04_006053	`PF23598.2`	LRR_14	157	250	8e-14	51.9
LXL04_006053	`PF13855.13`	LRR_8	182	225	4.8e-20	71.8
LXL04_006053	`PF00069.32`	Pkinase	473	634	3.7e-14	53.5
LXL04_006053	`PF07714.24`	PK_Tyr_Ser-Thr	475	734	3.9e-20	73.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFN2`	Arabidopsis thaliana	Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770	41.940%	Swiss-Prot	moderate database homology
`Q9M9S4`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g14390	34.771%	Swiss-Prot	moderate database homology
`Q9LYN8`	Arabidopsis thaliana	Leucine-rich repeat receptor protein kinase EMS1	29.329%	Swiss-Prot	weak database homology
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	28.728%	Swiss-Prot	weak database homology
`Q9FIZ3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO2	28.750%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card