TkA03G006200 | RubberDandelionOmics

Gene overview

TkA03G006200

Reference: TK1151 Chr: Chr03 Coordinates: 1507178-1509630 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1492 bp · TkA03G006200|TK1151|cDNA

GTAAACTCAACGAGTTAACTCGATTCGGTCCTTTTCTATTTGAAGGATAAAAACTGCTTTCGAGTTATTATGGAAATAAAACTCTGATTCTTTCGTTCACAGGCCCCCTGTAGATTTCTATAATCAAAAACCCTAATTTGTAACAAATCATTGATTCTGAACCCCAAATGTACGAAGAACAACAAGCAACTATGCCCAGTTTAACTTCATACCCCAGTCCTAACCCTAACCCTAACCAAATCATTGATTCGCATGGATTC...

CDS

Download CDS FASTA

1140 bp · TkA03G006200|TK1151|CDS

ATGTACGAAGAACAACAAGCAACTATGCCCAGTTTAACTTCATACCCCAGTCCTAACCCTAACCCTAACCAAATCATTGATTCGCATGGATTCGATGGCTCGGAAACACAACCCGCATTTGAGCTCGACGGAGCTATTTCACAGCTAGCCGATTCAATTACATCCGAAAAGGTGGCTGGCAACCTTGGTGACGTGGCAAACACAACGACAAGTCAGCCTGAACGCGTTCATTGTGAGGTATGCAATATTACTTGTAACAC...

Protein

Download Protein FASTA

379 aa · TkA03G006200|TK1151|PROTEIN

MYEEQQATMPSLTSYPSPNPNPNQIIDSHGFDGSETQPAFELDGAISQLADSITSEKVAGNLGDVANTTTSQPERVHCEVCNITCNTKVFEQHTRGKKHMKNMQKIAISSVIGPKVTPVTATATATSVGELENKKHMLLQNGASAHSLLYCQICNVVCNNQDALQAHLAGKKHSSKANLQLGSTNDVFTPTPQNHGPDYLRCDLCKISCTSFELLNTHLSGKKHLKKLKESEQIPDSTEGKIVISHDTTNPISCQLCGIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G006200`
TK1151 ID	TkA03G006200
OH-1004 ID	LXL04_030601
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G006200`
Location	Chr03:1507178-1509630 (+)
Description	Similar to znf346: Zinc finger protein 346
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030601` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003725 double-stranded RNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	dre:560756 xla:380471 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.861

Rank 1 · TkA03G006200 · TK1151

Cytoplasm0.174

Rank 2 · TkA03G006200 · TK1151

Cell membrane0.038

Rank 3 · TkA03G006200 · TK1151

Endoplasmic reticulum0.033

Rank 4 · TkA03G006200 · TK1151

Plastid0.017

Rank 5 · TkA03G006200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12756zf-C2H2_228-103 aa

PF23320Zn_SUZ1269-87 aa

PF05477SURF274-104 aa

PF17713DUF555875-101 aa

PF14697Fer4_2176-101 aa

PF11931SF3a60_Prp9_C76-111 aa

PF12874zf-met77-99 aa

PF06220zf-U177-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G006200	`PF12756`	zf-C2H2_2	28	103	9e-12	45.8
TkA03G006200	`PF23320`	Zn_SUZ12	69	87	4e-06	27.2
TkA03G006200	`PF05477`	SURF2	74	104	0.013	15.8
TkA03G006200	`PF17713`	DUF5558	75	101	0.26	12.5
TkA03G006200	`PF14697`	Fer4_21	76	101	0.002	18.9
TkA03G006200	`PF11931`	SF3a60_Prp9_C	76	111	7.2	7.9
TkA03G006200	`PF12874`	zf-met	77	99	1.9e-34	117.7
TkA03G006200	`PF06220`	zf-U1	77	105	3.1e-06	27.6
TkA03G006200	`PF13894`	zf-C2H2_4	77	89	0.00049	21.3
TkA03G006200	`PF07535`	zf-DBF	77	104	0.035	14.8
TkA03G006200	`PF23107`	Zf-C2H2_ZNF451_C	77	99	9.4	7.6
TkA03G006200	`PF12171`	zf-C2H2_jaz	78	99	5.2e-24	84.6
TkA03G006200	`PF00096`	zf-C2H2	78	88	0.00022	22.2
TkA03G006200	`PF25095`	C2H2-zf_KIN17	78	101	0.23	12.4
TkA03G006200	`PF06421`	LepA_C	78	109	0.43	11.4
TkA03G006200	`PF15803`	zf-SCNM1	93	101	2e-07	31.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card