LXL04_030601 | RubberDandelionOmics

Gene overview

LXL04_030601

Reference: OH-1004 Chr: Chr06 Coordinates: 119433201-119435304 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · LXL04_030601|LXL04_030601|OH1004|cDNA

ATGTACGAAGAACAACAAGCAACTATGCCCAGTTTAACTTCATACCCCAGTcctaaccctaaccctaacCAAATCATTGATTCGCATGGATTCGATGGCTCGGAAACACAACCCGCATTTGAGCTCGACGGAGCTATTTCACAGCTAGCCGATTCAATTACATCCGAAAAGGTGGCTGGCAACCTTGGTGACGTGGCAAACACAACGACAAGTCAGCCTGAACGCGTTCATTGTGAGGTATGCAATATTACTTGTAACAC...

CDS

Download CDS FASTA

1143 bp · LXL04_030601|LXL04_030601|OH1004|CDS

ATGTACGAAGAACAACAAGCAACTATGCCCAGTTTAACTTCATACCCCAGTCCTAACCCTAACCCTAACCAAATCATTGATTCGCATGGATTCGATGGCTCGGAAACACAACCCGCATTTGAGCTCGACGGAGCTATTTCACAGCTAGCCGATTCAATTACATCCGAAAAGGTGGCTGGCAACCTTGGTGACGTGGCAAACACAACGACAAGTCAGCCTGAACGCGTTCATTGTGAGGTATGCAATATTACTTGTAACAC...

Protein

Download Protein FASTA

380 aa · LXL04_030601|LXL04_030601|OH1004|PROTEIN

MYEEQQATMPSLTSYPSPNPNPNQIIDSHGFDGSETQPAFELDGAISQLADSITSEKVAGNLGDVANTTTSQPERVHCEVCNITCNTKEVFEQHTRGKKHMKNMQKIAISSVIGPKVTPVTATATATSVGELENKKHMLLQNGASAHSLLYCQICNVVCNNQDALQAHLAGKKHSSKANLQLGSTNDVFTPTPQNHGPDYLRCDLCKISCTSFELLNTHLSGKKHLKKLKESEQIPDSTEGKIVISHDTTNPISCQLCGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030601`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_030601`
Location	Chr06:119433201-119435304 (+)
Description	Similar to znf346: Zinc finger protein 346
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030601` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003725 double-stranded RNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	dre:560756 xla:380471 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.902

Rank 1 · LXL04_030601 · OH-1004

Cytoplasm0.138

Rank 2 · LXL04_030601 · OH-1004

Cell membrane0.033

Rank 3 · LXL04_030601 · OH-1004

Endoplasmic reticulum0.026

Rank 4 · LXL04_030601 · OH-1004

Plastid0.015

Rank 5 · LXL04_030601 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12874.14zf-met77-100 aa

PF12171.15zf-C2H2_jaz78-100 aa

PF12874.14zf-met150-174 aa

PF12171.15zf-C2H2_jaz150-174 aa

PF12874.14zf-met202-225 aa

PF12874.14zf-met254-277 aa

PF12171.15zf-C2H2_jaz254-278 aa

PF12874.14zf-met340-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030601	`PF12874.14`	zf-met	77	100	4.4e-39	132.4
LXL04_030601	`PF12171.15`	zf-C2H2_jaz	78	100	5.6e-27	94.0
LXL04_030601	`PF12874.14`	zf-met	150	174	4.4e-39	132.4
LXL04_030601	`PF12171.15`	zf-C2H2_jaz	150	174	5.6e-27	94.0
LXL04_030601	`PF12874.14`	zf-met	202	225	4.4e-39	132.4
LXL04_030601	`PF12874.14`	zf-met	254	277	4.4e-39	132.4
LXL04_030601	`PF12171.15`	zf-C2H2_jaz	254	278	5.6e-27	94.0
LXL04_030601	`PF12874.14`	zf-met	340	363	4.4e-39	132.4
LXL04_030601	`PF12171.15`	zf-C2H2_jaz	341	363	5.6e-27	94.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card