TkA02G615260 | RubberDandelionOmics

Gene overview

TkA02G615260

Reference: TK1151 Chr: Chr02 Coordinates: 158624993-158627198 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1662 bp · TkA02G615260|TK1151|cDNA

TTAATATTGGATGGTCAAGTCTTGTGGTTACGTCCTGGAAAAGTGTATTGACTACTGAAAAGCTTATCCGATCCTCTGCTTGGCTGCTCCATGATTAAACCTTCTTCTTCCTCTTTCCTCTGCGGTCGGGACATTCCGGCAGCATGCTTGAATCCATTTCCTTCAACACCGCTCCCTCTTCATGCTACTCGTACCTGCTGCTTTAATTTCTCCCCCACCCTACAAACCTATCAAATAACTCTACTCCTCTCCAGCCGCCG...

CDS

Download CDS FASTA

1530 bp · TkA02G615260|TK1151|CDS

ATGATTAAACCTTCTTCTTCCTCTTTCCTCTGCGGTCGGGACATTCCGGCAGCATGCTTGAATCCATTTCCTTCAACACCGCTCCCTCTTCATGCTACTCGTACCTGCTGCTTTAATTTCTCCCCCACCCTACAAACCTATCAAATAACTCTACTCCTCTCCAGCCGCCGCCGACTCTTCCTATGCAACGTTCTTCAACCCACCCATGGCATCGATTCAGGTTCAGGAACTTCAATGTTTGCGCTCTTCCTTGACATGGG...

Protein

Download Protein FASTA

509 aa · TkA02G615260|TK1151|PROTEIN

MIKPSSSSFLCGRDIPAACLNPFPSTPLPLHATRTCCFNFSPTLQTYQITLLLSSRRRLFLCNVLQPTHGIDSGSGTSMFALFLDMGISEKGADAILENHPALRLAPFQSIRNQINALQNLGISGPVLLRLIKKRPQVLISKEIHCLVCFLSDDLKDVIEAAQLARLLTATDPKYLSGFEAKVGLLLDLGIPIDRLGHVLNNVNLSKAICLKSCEEIGRLMGFLNGFGGVDLILRRPAILNFDLDSQLIPRIEFFLNLSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G615260`
TK1151 ID	TkA02G615260
OH-1004 ID	LXL04_037008
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	35.800
Protein coverage (%)	TK1151 18.271 / OH-1004 10.698 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G615260

Location Chr02:158624993-158627198 (+)

Description Similar to MTERF4: Transcription termination factor MTERF4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54180`	Transcription termination factor that is transcriptionally active in chloroplasts.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037008 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000460 maturation of 5.8S rRNA Biological Process

GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006396 RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0032502 developmental process Biological Process

GO:0034475 U4 snRNA 3'-end processing Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0042793 plastid transcription Biological Process

GO:0042794 plastid rRNA transcription Biological Process

KEGG gene cross-reference

ath:AT1G03360

ath:AT4G02990

dosa:Os05g0404000

spo:2541813

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.662

Rank 1 · TkA02G615260 · TK1151

Mitochondrion0.280

Rank 2 · TkA02G615260 · TK1151

Nucleus0.044

Rank 3 · TkA02G615260 · TK1151

Cytoplasm0.031

Rank 4 · TkA02G615260 · TK1151

Cell membrane0.012

Rank 5 · TkA02G615260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536mTERF82-365 aa

PF17363DUF5388109-123 aa

PF04695Pex14_N296-302 aa

PF02536mTERF320-484 aa

PF04695Pex14_N322-342 aa

PF17363DUF5388389-400 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G615260	`PF02536`	mTERF	82	365	9.2e-52	176.6
TkA02G615260	`PF17363`	DUF5388	109	123	0.28	12.0
TkA02G615260	`PF04695`	Pex14_N	296	302	0.06	13.7
TkA02G615260	`PF02536`	mTERF	320	484	9.2e-52	176.6
TkA02G615260	`PF04695`	Pex14_N	322	342	0.06	13.7
TkA02G615260	`PF17363`	DUF5388	389	400	0.28	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK23`	Arabidopsis thaliana	sp\|Q9FK23\|MTEF8_ARATH Transcription termination factor MTERF8, chloroplastic	40.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card