TkA02G610290 | RubberDandelionOmics

Gene overview

TkA02G610290

Reference: TK1151 Chr: Chr02 Coordinates: 157458645-157462630 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2823 bp · TkA02G610290|TK1151|cDNA

CCTATTTGAACTTTTAGTTGTCCAATACTCCAATATCATATGCGTCGAGTTTTTAGAAAGAATAGTCTCCTCACCAATTCGATAGTCGGCACTGAGTTCTCCGATCCTATTTCCAAATTCGTCAACGTGTGGGAACTTTTGCCGATCACAAAATCGTATCTTTTCTGAGGTTCGATTCGGTTTTCATAAGTTTTTGCATGCTTATCTTCTAATTACAGCAGTGTTTCATCAACAAATCGATTTGCGAGGGGTTTTATGTT...

CDS

Download CDS FASTA

2289 bp · TkA02G610290|TK1151|CDS

ATGCAATCGGGTGAAAATAAGAAGTTGAAATACTCCAATATCACTTGCAAGATGCCTCAGCCAGACAGTTGTGTAGATGACCAGATTCCTTTTTCAGTTGAGAAGATAGTGCAGTTCCCGTTACCTGGTTGTGGTTCTCCAGCTTCAGTTAATTTTAGTCCTGATGATAATCTTGTATCTTACTTGTTTAGTCCCGATCAAACATTAAACAGAAAAGTATTCATCTTTGATCTCACAACCTGTAAGCAAGAAGTGTTTTT...

Protein

Download Protein FASTA

762 aa · TkA02G610290|TK1151|PROTEIN

MQSGENKKLKYSNITCKMPQPDSCVDDQIPFSVEKIVQFPLPGCGSPASVNFSPDDNLVSYLFSPDQTLNRKVFIFDLTTCKQEVFFSPPDGGLDEDNLSEEEKLRRERSRERGLGVTRYEWVKTSPKKTTIMVPLPAGIYFMDRSLQPQLKLPCDSSPIIDPHLSPDGTMLAYVRNHELHALDLLYNRSKRLTSGANGTTKTHAVAEYIAQEEMDRRNGYWWSPDSKCIAFTEVDSSEIPLYRIMHQGKNTVGSDAQEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G610290`
TK1151 ID	TkA02G610290
OH-1004 ID	LXL04_011823
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 99.869 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G610290`
Location	Chr02:157458645-157462630 (-)
Description	Similar to dap4: Dipeptidyl aminopeptidase 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011823` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0006955 immune response Biological Process GO:0043069 negative regulation of programmed cell death Biological Process GO:0051603 proteolysis involved in protein catabolic process Biological Process GO:0051604 protein maturation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005874 microtubule Cellular Component GO:0031252 cell leading edge Cellular Component GO:0004177 aminopeptidase activity Molecular Function GO:0008236 serine-type peptidase activity Molecular Function
KEGG gene cross-reference	dre:768170 hsa:54878 hsa:91039 mmu:74388 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.719

Rank 1 · TkA02G610290 · TK1151

Nucleus0.350

Rank 2 · TkA02G610290 · TK1151

Mitochondrion0.128

Rank 3 · TkA02G610290 · TK1151

Cell membrane0.056

Rank 4 · TkA02G610290 · TK1151

Peroxisome0.044

Rank 5 · TkA02G610290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12697Abhydrolase_640-56 aa

PF00930DPPIV_N48-63 aa

PF07676PD4051-82 aa

PF26549Tricorn_N51-79 aa

PF26549Tricorn_N140-179 aa

PF07676PD40148-177 aa

PF00930DPPIV_N150-473 aa

PF26550Tricorn_2nd207-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G610290	`PF12697`	Abhydrolase_6	40	56	0.12	13.7
TkA02G610290	`PF00930`	DPPIV_N	48	63	3.5e-81	273.4
TkA02G610290	`PF07676`	PD40	51	82	0.019	14.8
TkA02G610290	`PF26549`	Tricorn_N	51	79	0.061	13.4
TkA02G610290	`PF26549`	Tricorn_N	140	179	0.061	13.4
TkA02G610290	`PF07676`	PD40	148	177	0.019	14.8
TkA02G610290	`PF00930`	DPPIV_N	150	473	3.5e-81	273.4
TkA02G610290	`PF26550`	Tricorn_2nd	207	247	0.0074	15.7
TkA02G610290	`PF07676`	PD40	223	247	0.019	14.8
TkA02G610290	`PF26549`	Tricorn_N	223	249	0.061	13.4
TkA02G610290	`PF20434`	BD-FAE	540	641	0.16	12.2
TkA02G610290	`PF07519`	Tannase	540	663	0.18	11.4
TkA02G610290	`PF00561`	Abhydrolase_1	542	657	0.00012	22.5
TkA02G610290	`PF12697`	Abhydrolase_6	556	669	0.12	13.7
TkA02G610290	`PF00326`	Peptidase_S9	563	761	7.9e-52	176.6
TkA02G610290	`PF12146`	Hydrolase_4	567	663	0.0032	17.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card