Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2296 bp · LXL04_011823|LXL04_011823|OH1004|cDNA
ATTACTGATGCAATCGGGTGAAAATAAGAAGTTGAAATACTCCAATATCACTTGCAAGATGCCTCAGCCAGACAGTTGTGTAGATGACCAGATTCCTTTTTCAGTTGAGAAGATAGTGCAGTTCCCGTTACCTGGTTGTGGTTCTCCAGCTTCAGTTAATTTTAGTCCTGATGATAATCTTGTATCTTACTTGTTTAGTCCCGATCAAACATTAAACAGAAAAGTATTCATCTTTGATCTCACAACCTGTAAGCAAGAAG...
2292 bp · LXL04_011823|LXL04_011823|OH1004|CDS
CTGATGCAATCGGGTGAAAATAAGAAGTTGAAATACTCCAATATCACTTGCAAGATGCCTCAGCCAGACAGTTGTGTAGATGACCAGATTCCTTTTTCAGTTGAGAAGATAGTGCAGTTCCCGTTACCTGGTTGTGGTTCTCCAGCTTCAGTTAATTTTAGTCCTGATGATAATCTTGTATCTTACTTGTTTAGTCCCGATCAAACATTAAACAGAAAAGTATTCATCTTTGATCTCACAACCTGTAAGCAAGAAGTGTT...
Protein
Download Protein FASTA763 aa · LXL04_011823|LXL04_011823|OH1004|PROTEIN
MMQSGENKKLKYSNITCKMPQPDSCVDDQIPFSVEKIVQFPLPGCGSPASVNFSPDDNLVSYLFSPDQTLNRKVFIFDLTTCKQEVFFSPPDGGLDEDNLSEEEKLRRERSRERGLGVTRYEWVKTSPKKTTIMVPLPAGIYFMDRSLQPQLKLPCDSSPIIDPHLSPDGTMLAYVRNHELHALDLLYNRSKRLTSGANGTTKTHAVAEYIAQEEMDRRNGYWWSPDSKCIAFTEVDSSEIPLYRIMHQGKNTVGSDAQE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_011823 |
|---|---|
| TK1151 ID | TkA02G610290 |
| OH-1004 ID | LXL04_011823 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 99.869Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_011823 |
|---|---|
| Location | Chr03:892256-894862 (+) |
| Description | Similar to dap4: Dipeptidyl aminopeptidase 4 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0006955 immune response Biological Process GO:0043069 negative regulation of programmed cell death Biological Process GO:0051603 proteolysis involved in protein catabolic process Biological Process GO:0051604 protein maturation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005874 microtubule Cellular Component GO:0031252 cell leading edge Cellular Component GO:0004177 aminopeptidase activity Molecular Function GO:0008236 serine-type peptidase activity Molecular Function |
| KEGG gene cross-reference | dre:768170 hsa:54878 hsa:91039 mmu:74388 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00930.28DPPIV_N151-474 aaPF02129.25Peptidase_S15521-669 aaPF00326.28Peptidase_S9564-762 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_011823 | PF00930.28 | DPPIV_N | 151 | 474 | 3.5e-81 | 273.4 |
| LXL04_011823 | PF02129.25 | Peptidase_S15 | 521 | 669 | 1.7e-08 | 35.2 |
| LXL04_011823 | PF00326.28 | Peptidase_S9 | 564 | 762 | 7.9e-52 | 176.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.