RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G592880
Reference: TK1151 Chr: Chr02 Coordinates: 152964214-152967293 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2620 bp · TkA02G592880|TK1151|cDNA

CGACGGTGCACCATAACCATGTACACCTGCAACATAGTAATCTGATCGAGCGGCCACGAAATACACTTCAGATTCCACCTTACATCTCGTGGACTCTCCCTCCAACCTTGACTTGCCAGCTGGTCTTCACAAGGGAACACTCTGCACCATCATCGTCTACATCTTCATCTGCAAAGACCTGTGAGAGAAAGAGAGAGAGAGAGAGTCAAAAAGAAAATTCCAACAAAACCCATGGCTCGTGCTGAAAACCACACTCCGAG...

CDS

Download CDS FASTA

2001 bp · TkA02G592880|TK1151|CDS

ATGGGTGTTTCATCGTTTCTTTTGTTGCTCTCTCTGTTCTTCACCATATTGTGTGCACCAACTGTTTGTGGAAACGCAGAGCTTCGAGCCCTGATGGACATCAAGACCAGTCTAGACCCATACAACCTACATTTGGGCTCCTGGACTGTATTGGGAAACCATTGCGACTTCGAAGGCGTTGGGTGCAATGAAATGGGTCAGGTCGCTAATATTTCTTTACAGGGGAAAGGTCTCTCCGGTAAACTCTCGCCGGCGTTTTC...

Protein

Download Protein FASTA

666 aa · TkA02G592880|TK1151|PROTEIN

MGVSSFLLLLSLFFTILCAPTVCGNAELRALMDIKTSLDPYNLHLGSWTVLGNHCDFEGVGCNEMGQVANISLQGKGLSGKLSPAFSELKHLTGLYLHYNSLSGDFPKEIANLTELSDLYLNVNNLSGSIPVELENMESLQVLQLCYNQFSGSIPTQLGSLKKLTVLSLQFNHLSGALPASLGDLALLTRLDLSFNRLFGSIPTRLADAPMLQVLDVRNNTLSGNVPLALQRLGEGFQFSNNFGLCGVDFTTLKACSALD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G592880
TK1151 IDTkA02G592880
OH-1004 IDLXL04_012011
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 94.737
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G592880
LocationChr02:152964214-152967293 (+)
DescriptionSimilar to NIK2: Protein NSP-INTERACTING KINASE 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g16670 Negative regulator of freezing tolerance that phosphorylates 14-3-3 proteins (e.g. GRF6) thus triggering their translocation from the cytosol to the nucleus in response to cold stress. No verified direct reference in this release
At1g19090 Cysteine-rich receptor-like protein kinase 1. No verified direct reference in this release
At4g23260 Cysteine-rich receptor-like protein kinase 18. No verified direct reference in this release
At1g34210 Serine/threonine-kinase involved in brassinosteroid-dependent and -independent signaling pathways.
Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0457800 LRR receptor kinase involved in positive regulation of somatic embryogenesis and defense response against the rice blast fungus pathogen Magnaporthe oryzae.
Rice SERK1 gene positively regulates somatic embryogenesis of cultured cell and host defense response against fungal infection.2005 · DOI: 10.1007/s00425-005-1534-4
An XA21-associated kinase (OsSERK2) regulates immunity mediated by the XA21 and XA3 immune receptors.2014 · DOI: 10.1093/mp/ssu003
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012011 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009611 response to wounding Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0042659 regulation of cell fate specification Biological Process
GO:0045184 establishment of protein localization Biological Process
GO:0048638 regulation of developmental growth Biological Process
GO:0051302 regulation of cell division Biological Process
GO:0055075 potassium ion homeostasis Biological Process
GO:0090708 specification of plant organ axis polarity Biological Process
GO:0160073 Casparian strip assembly Biological Process
KEGG gene cross-reference
ath:AT3G25560
ath:AT4G20140
dosa:Os02g0283800
osa:4329032
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.852
Rank 1 · TkA02G592880 · TK1151
Endoplasmic reticulum0.080
Rank 2 · TkA02G592880 · TK1151
Cytoplasm0.076
Rank 3 · TkA02G592880 · TK1151
Nucleus0.061
Rank 4 · TkA02G592880 · TK1151
Lysosome / Vacuole0.024
Rank 5 · TkA02G592880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_225-63 aa
PF06480FtsH_ext65-79 aa
PF00560LRR_171-89 aa
PF23598LRR_1481-219 aa
PF13855LRR_885-126 aa
PF12799LRR_490-130 aa
PF24758LRR_At5g5637090-150 aa
PF00560LRR_191-113 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G592880PF08263LRRNT_225632.1e-0628.6
TkA02G592880PF06480FtsH_ext65790.2312.4
TkA02G592880PF00560LRR_171892.3e-1657.1
TkA02G592880PF23598LRR_14812191.3e-0938.0
TkA02G592880PF13855LRR_8851262.3e-1453.6
TkA02G592880PF12799LRR_4901301.4e-1041.8
TkA02G592880PF24758LRR_At5g56370901500.113.0
TkA02G592880PF00560LRR_1911132.3e-1657.1
TkA02G592880PF00560LRR_11161372.3e-1657.1
TkA02G592880PF24758LRR_At5g563701191730.113.0
TkA02G592880PF00560LRR_11391612.3e-1657.1
TkA02G592880PF13855LRR_81391982.3e-1453.6
TkA02G592880PF12799LRR_41391741.4e-1041.8
TkA02G592880PF13516LRR_61391510.00417.8
TkA02G592880PF24758LRR_At5g563701612230.113.0
TkA02G592880PF12799LRR_41622021.4e-1041.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93YN1Arabidopsis thalianasp|Q93YN1|CRPK1_ARATH Cold-responsive protein kinase 135.400%Swiss-ProtLow
Q9LMB9Arabidopsis thalianasp|Q9LMB9|CRK1_ARATH Cysteine-rich receptor-like protein kinase 135.800%Swiss-ProtLow
Q8RX80Arabidopsis thalianasp|Q8RX80|CRK18_ARATH Cysteine-rich receptor-like protein kinase 1837.300%Swiss-ProtLow
Q9XIC7Arabidopsis thalianasp|Q9XIC7|SERK2_ARATH Somatic embryogenesis receptor kinase 231.800%Swiss-ProtLow
Q7XV05Oryza sativa subsp. japonicasp|Q7XV05|SERK2_ORYSJ LRR receptor kinase SERK232.200%Swiss-ProtLow

JBrowse

View in Genome Browser