TkA02G592750 | RubberDandelionOmics

Gene overview

TkA02G592750

Reference: TK1151 Chr: Chr02 Coordinates: 152928124-152929269 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

561 bp · TkA02G592750|TK1151|cDNA

ATGTTCTTTGCGATTCTATCCCCAATATGTGGCGGTTCGCCGGAAAAACGAAAAAGGGTGGCGTTTGATTCCCTTCTATGGTGGCCAGTAAACGAACAACAACAAGAGGGTAAAGGGCAAATCATAAGGGTCGATGCATTACATTATATTAAAATATTGCGATTAATTTACATTCCATCTCAAGGAACAAGCGAATTACTGGAAATCCATGGAGAAACCGATGATTCAATGGTTTCATTTACAGAGTTCACTGACATGTT...

CDS

Download CDS FASTA

561 bp · TkA02G592750|TK1151|CDS

ATGTTCTTTGCGATTCTATCCCCAATATGTGGCGGTTCGCCGGAAAAACGAAAAAGGGTGGCGTTTGATTCCCTTCTATGGTGGCCAGTAAACGAACAACAACAAGAGGGTAAAGGGCAAATCATAAGGGTCGATGCATTACATTATATTAAAATATTGCGATTAATTTACATTCCATCTCAAGGAACAAGCGAATTACTGGAAATCCATGGAGAAACCGATGATTCAATGGTTTCATTTACAGAGTTCACTGACATGTT...

Protein

Download Protein FASTA

186 aa · TkA02G592750|TK1151|PROTEIN

MFFAILSPICGGSPEKRKRVAFDSLLWWPVNEQQQEGKGQIIRVDALHYIKILRLIYIPSQGTSELLEIHGETDDSMVSFTEFTDMFDDSDWGFGILPTLMKLEFSDRNRHGKQSCGVCRYPIIGGKSGFSLCGQCYSEGKVPTSFKFDEYRFKEYVKESEAVKDKCMWFSLQKSSSGTATNIQGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G592750`
TK1151 ID	TkA02G592750
OH-1004 ID	LXL04_003225
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.300
Protein coverage (%)	TK1151 99.462 / OH-1004 51.075 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G592750

Location Chr02:152928124-152929269 (-)

Description Similar to At2g32450: Uncharacterized TPR repeat-containing protein At2g32450

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32450`	Uncharacterized TPR repeat-containing protein At2g32450.	No verified direct reference in this release
`At1g05150`	Uncharacterized TPR repeat-containing protein At1g05150.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003225 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007010 cytoskeleton organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0010005 cortical microtubule, transverse to long axis Cellular Component

KEGG gene cross-reference

ath:AT1G05150

ath:AT1G14840

ath:AT2G01750

ath:AT2G32450

dosa:Os02g0736100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · TkA02G592750 · TK1151

Nucleus0.375

Rank 2 · TkA02G592750 · TK1151

Mitochondrion0.133

Rank 3 · TkA02G592750 · TK1151

Cell membrane0.096

Rank 4 · TkA02G592750 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkA02G592750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03107C1_2103-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G592750	`PF03107`	C1_2	103	136	0.14	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8L9`	Arabidopsis thaliana	sp\|Q8S8L9\|Y2245_ARATH Uncharacterized TPR repeat-containing protein At2g32450	60.100%	Swiss-Prot	High
`O23052`	Arabidopsis thaliana	sp\|O23052\|Y1515_ARATH Uncharacterized TPR repeat-containing protein At1g05150	57.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card