Gene Card
Gene overview
cDNA / CDS / Protein Sequences
996 bp · TkA02G589410|TK1151|cDNA
ATCCAATGATTTTGCCATTGTGGGTAGGTAATGGTAGCTCGAAAATAAGCATGCGTAGGAGATTTAAAAACAGCAAGTATTTGACCAAATCGGATTGATATAAATAAAGTGCATCGATCCACTGATCCTGCTAACAACAAACACAACACTCTCACCATGGTTAAAGCAATTAGAGTTCATGAGAACGGTTGTCCTGAGGTCTTGAAATGGGAAGATGTGAAAGTCCCAGATCCAAAACAGGGAGAAATCAAGTTGAAGCA...
840 bp · TkA02G589410|TK1151|CDS
ATGGTTAAAGCAATTAGAGTTCATGAGAACGGTTGTCCTGAGGTCTTGAAATGGGAAGATGTGAAAGTCCCAGATCCAAAACAGGGAGAAATCAAGTTGAAGCAAACGGCAATTGGACTAAACTACTTGGATGTGTATATGCGTCAAGGTTTGTACCCCCAACCGGTACCGTTTACTCCAGGTATGGAAGGCGCCGGAGTTGTAACGGCAGTCGGTCCCGGAGTAACCACCTGCAAAATCGGCGACGTTGTGGCTTACGC...
Protein
Download Protein FASTA279 aa · TkA02G589410|TK1151|PROTEIN
MVKAIRVHENGCPEVLKWEDVKVPDPKQGEIKLKQTAIGLNYLDVYMRQGLYPQPVPFTPGMEGAGVVTAVGPGVTTCKIGDVVAYASPEVGSYAQERILPADQAVHVPSSVDPVEAAAVIFKGLTAYVLLHRSFKVERGHTILIHAAAGGVGSLLCQWASAKGATVIGTVSTQEKAVQAKEDGCHHVILYKDENFVDRVMGITGGKGVDVVYDSVGKDTFSGSLECLKMRGYMVCFGMASVLKVRVNHKYPLSQASQAH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G589410 |
|---|---|
| TK1151 ID | TkA02G589410 |
| OH-1004 ID | LXL04_012070 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 70.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G589410 |
|---|---|
| Location | Chr02:152106922-152108217 (-) |
| Description | Similar to caa43: 2-haloacrylate reductase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0042206 halogenated hydrocarbon catabolic process Biological Process GO:1990748 cellular detoxification Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0003960 quinone reductase (NADPH) activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Molecular Function GO:0035925 mRNA 3'-UTR AU-rich region binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0070402 NADPH binding Molecular Function GO:0102523 2-chloroacrylate reductase activity Molecular Function |
| KEGG gene cross-reference | ag:BAD91551 ecj:JW4011 eco:b4051 ecoc:C3026_21890 pae:PA0023 spo:2538826 stm:STM4245 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16884ADH_N_214-85 aaPF08240ADH_N28-109 aaPF00107ADH_zinc_N151-244 aaPF16884ADH_N_2162-182 aaPF08240ADH_N164-179 aaPF13602ADH_zinc_N_2184-239 aaPF13602ADH_zinc_N_2242-274 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G589410 | PF16884 | ADH_N_2 | 14 | 85 | 0.016 | 15.9 |
| TkA02G589410 | PF08240 | ADH_N | 28 | 109 | 4.2e-14 | 53.4 |
| TkA02G589410 | PF00107 | ADH_zinc_N | 151 | 244 | 5.6e-24 | 85.2 |
| TkA02G589410 | PF16884 | ADH_N_2 | 162 | 182 | 0.016 | 15.9 |
| TkA02G589410 | PF08240 | ADH_N | 164 | 179 | 4.2e-14 | 53.4 |
| TkA02G589410 | PF13602 | ADH_zinc_N_2 | 184 | 239 | 2.3e-16 | 61.6 |
| TkA02G589410 | PF13602 | ADH_zinc_N_2 | 242 | 274 | 2.3e-16 | 61.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.