LXL04_012070 | RubberDandelionOmics

Gene overview

LXL04_012070

Reference: OH-1004 Chr: Chr03 Coordinates: 5858435-5859739 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1054 bp · LXL04_012070|LXL04_012070|OH1004|cDNA

ATACAACACAAAGCAATACGACGTCTATTCAATCTTCTAAACAACACAGCACAACACAACCACCATGGTTAAAGCAATTAGAATTCATGAGCACGGCGGCCCTGAGGTCTTGAAATGGGAAGAAGTTGAAGTCCCAGATCCAAAAGAGGGAGAAATAAGATTGAAGCAAAAGGCAATTGGTCTAAATTACTTGGATGTATATAATCGTCAAAACTTGAGGAATCTAGCTCCACCGTTGCCATATACTCCAGGAATGGAAG...

CDS

Download CDS FASTA

990 bp · LXL04_012070|LXL04_012070|OH1004|CDS

ATGGTTAAAGCAATTAGAATTCATGAGCACGGCGGCCCTGAGGTCTTGAAATGGGAAGAAGTTGAAGTCCCAGATCCAAAAGAGGGAGAAATAAGATTGAAGCAAAAGGCAATTGGTCTAAATTACTTGGATGTATATAATCGTCAAAACTTGAGGAATCTAGCTCCACCGTTGCCATATACTCCAGGAATGGAAGGAGCCGGAGTTGTAACAGCGGTGGGTCCCGGAGTAACCAGCTGCAAAGTCGGAGACGTTGTGGC...

Protein

Download Protein FASTA

329 aa · LXL04_012070|LXL04_012070|OH1004|PROTEIN

MVKAIRIHEHGGPEVLKWEEVEVPDPKEGEIRLKQKAIGLNYLDVYNRQNLRNLAPPLPYTPGMEGAGVVTAVGPGVTSCKVGDVVAYASLQVGAYAQERILPADLAVPVPSSIDPVVAAAVIFKGLTTHVLINKGFKVERGHTILVHAAAGGVGSLLCQWASAKGATVIGTVSTQEKAVQAKEDGCHHVILYKDENFVDRVMEITSGKGVDVVYDSVGKDTLNGSLECLNYSGCLVNFGIASGVPEPVRYDQLVPKSLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012070`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_012070`
Location	Chr03:5858435-5859739 (+)
Description	Similar to caa43: 2-haloacrylate reductase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012070` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0042206 halogenated hydrocarbon catabolic process Biological Process GO:1990748 cellular detoxification Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0003960 quinone reductase (NADPH) activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Molecular Function GO:0035925 mRNA 3'-UTR AU-rich region binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0070402 NADPH binding Molecular Function GO:0102523 2-chloroacrylate reductase activity Molecular Function
KEGG gene cross-reference	ag:BAD91551 ecj:JW4011 eco:b4051 ecoc:C3026_21890 pae:PA0023 spo:2538826 stm:STM4245 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · LXL04_012070 · OH-1004

Mitochondrion0.218

Rank 2 · LXL04_012070 · OH-1004

Peroxisome0.173

Rank 3 · LXL04_012070 · OH-1004

Nucleus0.151

Rank 4 · LXL04_012070 · OH-1004

Cell membrane0.082

Rank 5 · LXL04_012070 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240.18ADH_N28-111 aa

PF00107.33ADH_zinc_N153-278 aa

PF13602.13ADH_zinc_N_2186-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012070	`PF08240.18`	ADH_N	28	111	5.4e-13	49.8
LXL04_012070	`PF00107.33`	ADH_zinc_N	153	278	3.8e-27	95.5
LXL04_012070	`PF13602.13`	ADH_zinc_N_2	186	324	2e-20	74.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card