TkA02G589030 | RubberDandelionOmics

Gene overview

TkA02G589030

Reference: TK1151 Chr: Chr02 Coordinates: 152013185-152015920 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1392 bp · TkA02G589030|TK1151|cDNA

CTGATCTCATTGGTAAACACTCCATCCGCTCACGATACGGAGATGAAAATGGCGGCCGGCTTGCTTCTCCTTCTCATCGCTCTTCTCTCCACGGTAACAGGAGATGAGGCTAAGAGTTCAAGTAATTTTCCATTAGTAGTAAGCACCTGGCCCTTCTTAGAAGCTGTGAGAGCTGGATGGAGGGCTATCAATGGTGGATTATCTCCCATTGATGCAGTTGTTGAAGGTTGTTCAGCTTGTGAGATACTTAGATGTGATGG...

CDS

Download CDS FASTA

771 bp · TkA02G589030|TK1151|CDS

ATGGAGGTTGGAGCTGTTGCAGCCATGAGATACGTGAAAGATGGAATCAAAGCTGCAAGATTAGTAATGCTTCACACAGAACACACAATGCTTGTGGGAGATCAGGCTTCAGCTTTTGCCATTTCAATGGGTCTTCAAGGACCTTCAAATCTTAGCTCAATAGAATCAATGGAAAAATGGATTAAATGGAAGGAAAATCAGTGTCAACCTAATTTTAGGAAAAACGTTGTACCTACAGACAGCTGTGGTCCTTATTATAG...

Protein

Download Protein FASTA

256 aa · TkA02G589030|TK1151|PROTEIN

MEVGAVAAMRYVKDGIKAARLVMLHTEHTMLVGDQASAFAISMGLQGPSNLSSIESMEKWIKWKENQCQPNFRKNVVPTDSCGPYYRKKDVNLDDKTCLVEDVAENIRMKSSYVDFHNHDTISMAIFDKSGHIAVGTSTNGASFKIPGRVGDGPIAGSSAYADDEIGACGATGDGDIMMRFLPCYQVVESMRLGMEPRLAAKDAISRIARKYPNFVGAIFAVDKNGTHAGACHGWVFQYSVKSPSMDDVEVITVYP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G589030`
TK1151 ID	TkA02G589030
OH-1004 ID	LXL04_012071
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 99.219 / OH-1004 23.049 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G589030

Location Chr02:152013185-152015920 (-)

Description Similar to CERK: Ceramide kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61540`	Acts in asparagine catabolism but also in the final steps of protein degradation via hydrolysis of a range of isoaspartyl dipeptides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012071 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006517 protein deglycosylation Biological Process

GO:0006672 ceramide metabolic process Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009651 response to salt stress Biological Process

GO:0012501 programmed cell death Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005764 lysosome Cellular Component

KEGG gene cross-reference

ath:AT5G51290

ath:AT5G61540

dosa:Os02g0656200

dya:Dyak_GE19290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.764

Rank 1 · TkA02G589030 · TK1151

Nucleus0.429

Rank 2 · TkA02G589030 · TK1151

Peroxisome0.072

Rank 3 · TkA02G589030 · TK1151

Mitochondrion0.066

Rank 4 · TkA02G589030 · TK1151

Cell membrane0.064

Rank 5 · TkA02G589030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01112Asparaginase_21-233 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G589030	`PF01112`	Asparaginase_2	1	233	2.3e-52	178.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56W64`	Arabidopsis thaliana	sp\|Q56W64\|ASPG3_ARATH Probable isoaspartyl peptidase/L-asparaginase 3	71.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card