TkA02G588200 | RubberDandelionOmics

Gene overview

TkA02G588200

Reference: TK1151 Chr: Chr02 Coordinates: 151795347-151800062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2327 bp · TkA02G588200|TK1151|cDNA

ATTCCTTCCTCTGTATTAGCTGTAACGTTGAACGCCAAATGCGGAGTTGGTGACATAATCACCGTCACAGAAGTCATCACTTGATCACCAAACTCCGCGGTCTCACCGGGGGCACATTCTCTACGTTTACCTCTCTCTACAGCAGTGTTGGGGGCTCTTAACAGCTAAGGTCTGCAGGGCCAAAAGGTGACCCTGAAGAGGTGCAGATAGCTATGAATTTGCGTTTTGGCATTGTCTAACAAGAATGCCAGGCATACCTT...

CDS

Download CDS FASTA

1266 bp · TkA02G588200|TK1151|CDS

ATGGGGAAGATTCCACTTGATTTCCTTCATCTGTCATGGGAGAAATCCCCAAATTTAAGTTTAGGAGAGAGAGTTGAGGTGATGTCAACTGTGAGCATGCAGTCCTGTTTTATGAAGTTAACTGGTACTTCAGCTAAGGAGAAATGTCTATCTTTTCAGCTTCCATATAATTCTGAAGCTGTGAGTATATTGCAGCAAGTACCTGTGATGATATCTGCTGAAGAGCTTGGGGCAAAAGATATATCACCTTATGACGTTTA...

Protein

Download Protein FASTA

421 aa · TkA02G588200|TK1151|PROTEIN

MGKIPLDFLHLSWEKSPNLSLGERVEVMSTVSMQSCFMKLTGTSAKEKCLSFQLPYNSEAVSILQQVPVMISAEELGAKDISPYDVYSYNNIPRNSMPHVIRLRTGNVVFNYKYYNNILQRSEVTEDYSCPFCLVKCASYKGLKLHLVSSHDLFRFEFWVNEDYQVVIVSVKSDTGTSEIFGNIADPRQQSLFFCRKPLSRKDPTLKTNHVLPSVLDSDVPATLANLRGDSEPMEIDIYSPNAKDVTGPESPQTLPATKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G588200`
TK1151 ID	TkA02G588200
OH-1004 ID	LXL04_012085
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 68.013 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G588200

Location Chr02:151795347-151800062 (+)

Description Similar to EMF2: Polycomb group protein EMBRYONIC FLOWER 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q8L6Y4`	Polycomb group (PcG) protein.	No verified direct reference in this release
`At4g16845`	Polycomb group (PcG) protein.	The VERNALIZATION 2 gene mediates the epigenetic regulation of vernalization in Arabidopsis.2001 · DOI: 10.1016/s0092-8674(01)00573-6 A PHD-polycomb repressive complex 2 triggers the epigenetic silencing of FLC during vernalization.2008 · DOI: 10.1073/pnas.0808687105
`UniProt: P0DKJ7`	Polycomb group (PcG) protein.	No verified direct reference in this release
`At2g35670`	Polycomb group (PcG) protein.	Identification of new members of Fertilisation Independent Seed Polycomb Group pathway involved in the control of seed development in Arabidopsis thaliana.2004 · DOI: 10.1242/dev.01168

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0306800`	Polycomb group (PcG) protein.	Expression, imprinting, and evolution of rice homologs of the polycomb group genes.2009 · DOI: 10.1093/mp/ssp036
`Os04g0162100`	Polycomb group (PcG) protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012085 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009908 flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010048 vernalization response Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

GO:0141044 epigenetic programming in the endosperm Biological Process

GO:0005634 nucleus Cellular Component

GO:0005677 chromatin silencing complex Cellular Component

KEGG gene cross-reference

ath:AT4G16845

ath:AT5G51230

dosa:Os04g0162100

dosa:Os09g0306800

osa:4335036

osa:4346674

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.877

Rank 1 · TkA02G588200 · TK1151

Cytoplasm0.196

Rank 2 · TkA02G588200 · TK1151

Cell membrane0.028

Rank 3 · TkA02G588200 · TK1151

Mitochondrion0.027

Rank 4 · TkA02G588200 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA02G588200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24663DUF76511-79 aa

PF23320Zn_SUZ12106-173 aa

PF13894zf-C2H2_4128-151 aa

PF13894zf-C2H2_4194-211 aa

PF09733VEFS-Box277-399 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G588200	`PF24663`	DUF7651	1	79	9.8e-30	104.3
TkA02G588200	`PF23320`	Zn_SUZ12	106	173	8.1e-32	109.5
TkA02G588200	`PF13894`	zf-C2H2_4	128	151	2.5	9.7
TkA02G588200	`PF13894`	zf-C2H2_4	194	211	2.5	9.7
TkA02G588200	`PF09733`	VEFS-Box	277	399	6.9e-53	178.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L6Y4`	Arabidopsis thaliana	sp\|Q8L6Y4\|EMF2_ARATH Polycomb group protein EMBRYONIC FLOWER 2	54.200%	Swiss-Prot	High
`Q8W5B1`	Arabidopsis thaliana	sp\|Q8W5B1\|VRN2_ARATH Polycomb group protein VERNALIZATION 2	49.900%	Swiss-Prot	Medium
`P0DKJ7`	Arabidopsis thaliana	sp\|P0DKJ7\|FIS2L_ARATH Polycomb group protein FERTILIZATION-INDEPENDENT SEED 2	45.700%	Swiss-Prot	Low
`P0DKJ8`	Arabidopsis thaliana	sp\|P0DKJ8\|FIS2C_ARATH Polycomb group protein FERTILIZATION-INDEPENDENT SEED 2	41.900%	Swiss-Prot	Low
`Q69KN0`	Oryza sativa subsp. japonica	sp\|Q69KN0\|EMF2B_ORYSJ Polycomb group protein EMF2B	52.700%	Swiss-Prot	High
`Q0JF48`	Oryza sativa subsp. japonica	sp\|Q0JF48\|EMF2A_ORYSJ Polycomb group protein EMF2A	46.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card