TkA02G588030 | RubberDandelionOmics

Gene overview

TkA02G588030

Reference: TK1151 Chr: Chr02 Coordinates: 151743067-151744525 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · TkA02G588030|TK1151|cDNA

ATGGATACTTGCTTTGTTTTTCTCTTTATCATAGTTATTATCGCCTCATTTTCTTCAAATACTACAGCCGAGATATATGAGCCTTTGGATAGTGTAATGTTGCATTACAATGTTTCGATCACTAACATGGGGCTTTCGGGACTGAAGGTGCATTGTACATCCTCATTTTCAAAATACGATGATTTGGGATCTCACATACTCAATTCAGAGGATGAATATGAATTCAGTTTCGATGTACACGACGATGAAAGAGTCACATA...

CDS

Download CDS FASTA

441 bp · TkA02G588030|TK1151|CDS

ATGGATACTTGCTTTGTTTTTCTCTTTATCATAGTTATTATCGCCTCATTTTCTTCAAATACTACAGCCGAGATATATGAGCCTTTGGATAGTGTAATGTTGCATTACAATGTTTCGATCACTAACATGGGGCTTTCGGGACTGAAGGTGCATTGTACATCCTCATTTTCAAAATACGATGATTTGGGATCTCACATACTCAATTCAGAGGATGAATATGAATTCAGTTTCGATGTACACGACGATGAAAGAGTCACATA...

Protein

Download Protein FASTA

146 aa · TkA02G588030|TK1151|PROTEIN

MDTCFVFLFIIVIIASFSSNTTAEIYEPLDSVMLHYNVSITNMGLSGLKVHCTSSFSKYDDLGSHILNSEDEYEFSFDVHDDERVTYSCDFQRHRKYKHIHVYNRNLQHQCGNGSVNTYQNPIFDNSFYIYDISQNPQKYVLMYNW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G588030`
TK1151 ID	TkA02G588030
OH-1004 ID	LXL04_012091
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.700
Protein coverage (%)	TK1151 96.575 / OH-1004 62.241 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G588030`
Location	Chr02:151743067-151744525 (-)
Description	Similar to RAD51C: DNA repair protein RAD51 homolog 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012091` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000707 meiotic DNA recombinase assembly Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0007131 reciprocal meiotic recombination Biological Process GO:0007140 male meiotic nuclear division Biological Process GO:0007143 female meiotic nuclear division Biological Process GO:0016444 somatic cell DNA recombination Biological Process GO:0045003 double-strand break repair via synthesis-dependent strand annealing Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0005634 nucleus Cellular Component GO:0005657 replication fork Cellular Component GO:0033063 Rad51B-Rad51C-Rad51D-XRCC2 complex Cellular Component GO:0033065 Rad51C-XRCC3 complex Cellular Component
KEGG gene cross-reference	ath:AT2G45280 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.344

Rank 1 · TkA02G588030 · TK1151

Lysosome / Vacuole0.296

Rank 2 · TkA02G588030 · TK1151

Cytoplasm0.186

Rank 3 · TkA02G588030 · TK1151

Endoplasmic reticulum0.177

Rank 4 · TkA02G588030 · TK1151

Cell membrane0.107

Rank 5 · TkA02G588030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05938Self-incomp_S146-146 aa

PF21816Zap1_zf152-68 aa

PF16680Ig_472-105 aa

PF30020zf-C2H2_ATbp_3rd88-99 aa

PF21816Zap1_zf190-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G588030	`PF05938`	Self-incomp_S1	46	146	1.3e-12	48.9
TkA02G588030	`PF21816`	Zap1_zf1	52	68	0.1	13.1
TkA02G588030	`PF16680`	Ig_4	72	105	0.18	13.1
TkA02G588030	`PF30020`	zf-C2H2_ATbp_3rd	88	99	0.12	13.0
TkA02G588030	`PF21816`	Zap1_zf1	90	100	0.1	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card