LXL04_012091 | RubberDandelionOmics

Gene overview

LXL04_012091

Reference: OH-1004 Chr: Chr03 Coordinates: 6194053-6198645 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · LXL04_012091|LXL04_012091|OH1004|cDNA

ATGGATACTTGCTTTGTTTTTCTCTTTATCATAGTTATTATCGCCTCATTTTCTTCAAATACTACAGCCGAGATATATGAGCCTTTGGATAGTGTAATGTTGCATTACAATGTTTCGATCACTAACATGGGGCTTTCGAGACTGAAGGTGCATTGTACATCCTCATTTTCAAAATACGATGATTTGGGATCTCACATACTCAATTCAGAGGATGAATATGAATTCAGTTTCGATGTACACGAAGATGAAAGAGTCACATA...

CDS

Download CDS FASTA

726 bp · LXL04_012091|LXL04_012091|OH1004|CDS

ATGGATACTTGCTTTGTTTTTCTCTTTATCATAGTTATTATCGCCTCATTTTCTTCAAATACTACAGCCGAGATATATGAGCCTTTGGATAGTGTAATGTTGCATTACAATGTTTCGATCACTAACATGGGGCTTTCGAGACTGAAGGTGCATTGTACATCCTCATTTTCAAAATACGATGATTTGGGATCTCACATACTCAATTCAGAGGATGAATATGAATTCAGTTTCGATGTACACGAAGATGAAAGAGTCACATA...

Protein

Download Protein FASTA

241 aa · LXL04_012091|LXL04_012091|OH1004|PROTEIN

MDTCFVFLFIIVIIASFSSNTTAEIYEPLDSVMLHYNVSITNMGLSRLKVHCTSSFSKYDDLGSHILNSEDEYEFSFDVHEDERVTYSCDFQRHRKYKHIHVYNRNLQHQCGNGSVNTCDWMMVILTGQNPVFDNSFYIYDTSQNPQKYVRFCQQSFLRLTQKRELCILIVIANNSHININAAQSEWDMLQEGETLIRITTSTSDFDNILGGDKYNKSNIKNKYEQKYFLQVLKQKYYQHP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012091`
TK1151 ID	TkA02G588030
OH-1004 ID	LXL04_012091
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.700
Protein coverage (%)	TK1151 96.575 / OH-1004 62.241 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012091

Location Chr03:6194053-6198645 (+)

Description Similar to RAD51C: DNA repair protein RAD51 homolog 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45280`	Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012091 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000707 meiotic DNA recombinase assembly Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0007143 female meiotic nuclear division Biological Process

GO:0016444 somatic cell DNA recombination Biological Process

GO:0045003 double-strand break repair via synthesis-dependent strand annealing Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005657 replication fork Cellular Component

GO:0033063 Rad51B-Rad51C-Rad51D-XRCC2 complex Cellular Component

GO:0033065 Rad51C-XRCC3 complex Cellular Component

KEGG gene cross-reference

ath:AT2G45280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.266

Rank 1 · LXL04_012091 · OH-1004

Extracellular0.226

Rank 2 · LXL04_012091 · OH-1004

Cytoplasm0.216

Rank 3 · LXL04_012091 · OH-1004

Endoplasmic reticulum0.208

Rank 4 · LXL04_012091 · OH-1004

Cell membrane0.166

Rank 5 · LXL04_012091 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05938.18Self-incomp_S146-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012091	`PF05938.18`	Self-incomp_S1	46	123	8.2e-11	43.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXF0`	Arabidopsis thaliana	DNA repair protein RAD51 homolog 3	64.103%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card