RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G585270
Reference: TK1151 Chr: Chr02 Coordinates: 151034423-151035836 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

790 bp · TkA02G585270|TK1151|cDNA

TGATATTTGATACTTGCGCTGTTAACATTTGCTTCCTTTTTAAGTTTTAGATCCACTCGCGGCTCGCCTCAGGTCAACCGCACAGACTGAAAATCTACCGATTCCAAACAGCAACCGCTAAAACATATTCAGAGAAGACAAATAAGAACAAAGATGTCGCCGCATGGTCATCATCCTCCACCGTCTCATCATCATCATTCTCCGCCGTCTCACCATCCTCCACCACCTCATCACCATCCTCCTCCACCACCTCATCATCA...

CDS

Download CDS FASTA

420 bp · TkA02G585270|TK1151|CDS

ATGTCGCCGCATGGTCATCATCCTCCACCGTCTCATCATCATCATTCTCCGCCGTCTCACCATCCTCCACCACCTCATCACCATCCTCCTCCACCACCTCATCATCATACGCCACCTCCTCATCATCCTCCTCCACAATTTCATCATCCTCCTCCACCGCCTCATCATCATCCTCCACACCCACCGCCTCCTCATCATCCGACACCTCACTATCAGCCACCTCCACCTGCTTATTATTATCCGGCACCTCATCCGCCAGG...

Protein

Download Protein FASTA

139 aa · TkA02G585270|TK1151|PROTEIN

MSPHGHHPPPSHHHHSPPSHHPPPPHHHPPPPPHHHTPPPHHPPPQFHHPPPPPHHHPPHPPPPHHPTPHYQPPPPAYYYPAPHPPGHIHHDGPQDNACLSLCCCPCLMVSSCISCLCYPLLRCFGLDRHHHSPPDRLY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G585270
TK1151 IDTkA02G585270
OH-1004 IDLXL04_012149
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)63.300
Protein coverage (%)TK1151 35.252 / OH-1004 14.080
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G585270
LocationChr02:151034423-151035836 (-)
DescriptionSimilar to UGT73C3: UDP-glycosyltransferase 73C3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012149 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009617 response to bacterium Biological Process
GO:0009636 response to toxic substance Biological Process
GO:0010224 response to UV-B Biological Process
GO:0051555 flavonol biosynthetic process Biological Process
GO:0051707 response to other organism Biological Process
GO:0009507 chloroplast Cellular Component
GO:0033836 flavonol 7-O-beta-glucosyltransferase activity Molecular Function
GO:0035251 UDP-glucosyltransferase activity Molecular Function
GO:0047893 flavonol 3-O-glucosyltransferase activity Molecular Function
GO:0050403 trans-zeatin O-beta-D-glucosyltransferase activity Molecular Function
GO:0050502 cis-zeatin O-beta-D-glucosyltransferase activity Molecular Function
GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function
KEGG gene cross-reference
ath:AT2G36750
ath:AT2G36770
ath:AT2G36780
ath:AT4G34135
ath:AT4G34138
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.645
Rank 1 · TkA02G585270 · TK1151
Nucleus0.235
Rank 2 · TkA02G585270 · TK1151
Cytoplasm0.200
Rank 3 · TkA02G585270 · TK1151
Endoplasmic reticulum0.066
Rank 4 · TkA02G585270 · TK1151
Extracellular0.054
Rank 5 · TkA02G585270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser