RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G585060
Reference: TK1151 Chr: Chr02 Coordinates: 150957956-150960263 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1492 bp · TkA02G585060|TK1151|cDNA

ATAATAGTACTTTGTTTATCGGATAAATGAGACATAAACCCGACCCGGTAAGCCCAACCGCTGAAGTCAAGTAGTCAACTAACCAGTAACAGATAAACGGCGAATCGACCCGAATTACTAACGAGATCCAGACACCCCATCATCTTCTGCCTCAGACAAGCAAACAACTGAAAACACACAAACAAACAGGATATTGTAGAGAGAAGGTGTAGACTATACGCGATTCGTCGAAATGCAAGATCCGTCCAATCTAAATACTA...

CDS

Download CDS FASTA

1056 bp · TkA02G585060|TK1151|CDS

ATGCAAGATCCGTCCAATCTAAATACTAAGCCGCAAAATGCGGCGGCGTTTCCGTTTAGGCCATCTCATCACCGACGAGCACACTCCGAGATGAACTTCAGGCTACCGGACGATCTAGATCTGGCCTCAGACCCCTACGATGCACCGTCCGAAAGCTTCGAAGAGTTAGGATCTGAGGAAGATCTGTTTTGTACTTACATGGATATTGAGAAGCTCGGATCCAACTTGAACGATGGCGGTGCTCTGGATAACGGTCGGAT...

Protein

Download Protein FASTA

351 aa · TkA02G585060|TK1151|PROTEIN

MQDPSNLNTKPQNAAAFPFRPSHHRRAHSEMNFRLPDDLDLASDPYDAPSESFEELGSEEDLFCTYMDIEKLGSNLNDGGALDNGRINNAGGSGGPSEDDNGGGGGDGERTGTRPRHRHSNSVDSSSFFSESIEAKKAMAPDKLAELWTVDPKRAKRILANRQSAARSKERKARYMSELERKVQTLQTEATTLSAQLTLFQRDTTGLSSENTELKLRLQAMEQQAHLRDALNEALKEEVDRLRMATGEMPNCSDGYNLGM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G585060
TK1151 IDTkA02G585060
OH-1004 IDLXL04_012156
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G585060
LocationChr02:150957956-150960263 (-)
DescriptionSimilar to BZIP18: bZIP transcription factor 18
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g40620 Transcription factor that may participate with bZIP34 in the gametophytic control of pollen development.
Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.2017 · DOI: 10.1007/s00497-016-0295-5
At2g31370 Putative transcription factor with an activatory role. No verified direct reference in this release
At1g43700 Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3.
Isolation and characterization of low-sulphur-tolerant mutants of Arabidopsis.2010 · DOI: 10.1093/jxb/erq161

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0336200 Transcription factor probably involved in vascular development and shoot tissue organization.
RF2b, a rice bZIP transcription activator, interacts with RF2a and is involved in symptom development of rice tungro disease.2004 · DOI: 10.1073/pnas.0307687100
Os09g0516200 Transcription factor probably involved in vascular development and shoot tissue organization.
Transcription factor RF2a alters expression of the rice tungro bacilliform virus promoter in transgenic tobacco plants.2001 · DOI: 10.1073/pnas.121186398
Functional analysis of RF2a, a rice transcription factor.2003 · DOI: 10.1074/jbc.m304862200
RF2b, a rice bZIP transcription activator, interacts with RF2a and is involved in symptom development of rice tungro disease.2004 · DOI: 10.1073/pnas.0307687100
RF2a, a bZIP transcriptional activator of the phloem-specific rice tungro bacilliform virus promoter, functions in vascular development.1997 · DOI: 10.1093/emboj/16.17.5247
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012156 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006952 defense response Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0007231 osmosensory signaling pathway Biological Process
GO:0009294 DNA-mediated transformation Biological Process
GO:0009652 thigmotropism Biological Process
GO:0009970 cellular response to sulfate starvation Biological Process
GO:0045596 negative regulation of cell differentiation Biological Process
GO:0051170 import into nucleus Biological Process
GO:1902358 sulfate transmembrane transport Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT1G43700
ath:AT2G31370
ath:AT2G40620
dosa:Os03g0336200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974
Rank 1 · TkA02G585060 · TK1151
Cytoplasm0.105
Rank 2 · TkA02G585060 · TK1151
Cell membrane0.026
Rank 3 · TkA02G585060 · TK1151
Endoplasmic reticulum0.013
Rank 4 · TkA02G585060 · TK1151
Plastid0.009
Rank 5 · TkA02G585060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27044HAUS3_CC58-77 aa
PF26095CC_Bre1126-224 aa
PF07299EF-G-binding_N132-186 aa
PF07716bZIP_2151-200 aa
PF00170bZIP_1153-210 aa
PF03131bZIP_Maf153-213 aa
PF11559ADIP159-245 aa
PF14662KASH_CCD162-249 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G585060PF27044HAUS3_CC58770.4711.4
TkA02G585060PF26095CC_Bre11262240.1313.3
TkA02G585060PF07299EF-G-binding_N1321860.1813.0
TkA02G585060PF07716bZIP_21512001.1e-0629.3
TkA02G585060PF00170bZIP_11532101.6e-0835.2
TkA02G585060PF03131bZIP_Maf1532130.5211.6
TkA02G585060PF11559ADIP1592451.89.4
TkA02G585060PF14662KASH_CCD1622490.006517.2
TkA02G585060PF06785UPF02421652390.1912.5
TkA02G585060PF05557MAD1662460.001517.7
TkA02G585060PF10473CENP-F_leu_zip1672400.2512.1
TkA02G585060PF26666DUF82211682150.9510.3
TkA02G585060PF19579FtsL_21692002.19.0
TkA02G585060PF07989Cnn_1N1721970.411.6
TkA02G585060PF15070GOLGA2L51742290.01814.6
TkA02G585060PF08614ATG161742460.04714.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O22873Arabidopsis thalianasp|O22873|BZP18_ARATH bZIP transcription factor 1852.700%Swiss-ProtHigh
Q04088Arabidopsis thalianasp|Q04088|POF21_ARATH Probable transcription factor PosF2150.200%Swiss-ProtHigh
Q9MA75Arabidopsis thalianasp|Q9MA75|VIP1_ARATH Transcription factor VIP159.900%Swiss-ProtLow
Q6S4P4Oryza sativa subsp. japonicasp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b51.900%Swiss-ProtHigh
Q69IL4Oryza sativa subsp. japonicasp|Q69IL4|RF2A_ORYSJ Transcription factor RF2a54.400%Swiss-ProtMedium

JBrowse

View in Genome Browser