Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3026 bp · TkA02G582230|TK1151|cDNA
AAAGAACTCAAAGTTAAAACCAACTTAAAATTTAACTACATTTTCGTCATCGTCTTCGTCTCTCCAAGAACGCAACACAGACTGGTGAAGTCCCCTTCTTATATGTTTAATCTCCTTCGACCCTATATAAACCGCCGAGCCCTAGTCTCTGTTTGCAATTTCTACAATTCAATCGTCAACCCTATCTTCTCTATATTTTCCCCCAATATGGACCCCGATGATGCACCACAACCAGAATTCGATCCACGTGTGCCCTCCAC...
2535 bp · TkA02G582230|TK1151|CDS
AAAGAACTCAAAGTTAAAACCAACTTAAAATTTAACTACATTTTCGTCATCGTCTTCGTCTCTCCAAGAACGCAACACAGACTGGTGAAGTCCCCTTCTTATATGTTTAATCTCCTTCGACCCTATATAAACCGCCGAGCCCTAGTCTCTGTTTGCAATTTCTACAATTCAATCGTCAACCCTATCTTCTCTATATTTTCCCCCAATATGGACCCCGATGATGCACCACAACCAGAATTCGATCCACGTGTGCCCTCCAC...
Protein
Download Protein FASTA844 aa · TkA02G582230|TK1151|PROTEIN
KELKVKTNLKFNYIFVIVFVSPRTQHRLVKSPSYMFNLLRPYINRRALVSVCNFYNSIVNPIFSIFSPNMDPDDAPQPEFDPRVPSTPVSYPIKTLEDLKLRTYFDSFHFQFNKASVSLSRSGVDDASLPNRRRIMACHDMQGGYTDDKWIQGGSNADAYSIWHWYLMDVFIYFSHNLVTLPPPGWVNAAHKHGVKVLGTFIVEWGEGSLIADQFLATTTAAHMYAERLSELAGALGFDGWLINMEVSLDTARIPTLKEF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G582230 |
|---|---|
| TK1151 ID | TkA02G582230 |
| OH-1004 ID | LXL04_012197 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.200 |
| Protein coverage (%) | TK1151 96.801 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G582230 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:150216919-150230137 (-) | |||||||||
| Description | Similar to ENGASE2: Cytosolic endo-beta-N-acetylglucosaminidase 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0006491 N-glycan processing Biological Process GO:0006517 protein deglycosylation Biological Process GO:0005615 extracellular space Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005764 lysosome Cellular Component GO:0005773 vacuole Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0016231 beta-N-acetylglucosaminidase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0033925 mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT5G05460 hsa:64772 mmu:217364 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03644Glyco_hydro_85145-422 aaPF23916TIM-barrel_EndoS186-286 aaPF25529Ig_ENGASE1_C625-732 aaPF30834DUF8748749-777 aaPF06839Zn_ribbon_GRF751-790 aaPF30834DUF8748783-790 aaPF03908Sec20810-841 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G582230 | PF03644 | Glyco_hydro_85 | 145 | 422 | 3e-101 | 339.6 |
| TkA02G582230 | PF23916 | TIM-barrel_EndoS | 186 | 286 | 0.0052 | 17.2 |
| TkA02G582230 | PF25529 | Ig_ENGASE1_C | 625 | 732 | 7.6e-25 | 88.0 |
| TkA02G582230 | PF30834 | DUF8748 | 749 | 777 | 0.038 | 15.0 |
| TkA02G582230 | PF06839 | Zn_ribbon_GRF | 751 | 790 | 5.7e-07 | 30.3 |
| TkA02G582230 | PF30834 | DUF8748 | 783 | 790 | 0.038 | 15.0 |
| TkA02G582230 | PF03908 | Sec20 | 810 | 841 | 0.048 | 14.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.