LXL04_012197 | RubberDandelionOmics

Gene overview

LXL04_012197

Reference: OH-1004 Chr: Chr03 Coordinates: 8179298-8183304 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2568 bp · LXL04_012197|LXL04_012197|OH1004|cDNA

AAAGAACTCAAAGTTAAAACCAACTTAAAATTTAACTACATTTTCGTCATCGTCTTCGTCTCTCCAAGAACGCAACACAGACTGGTGAAGTCCCCTTCTTATATGTTTAATCTCCTTCGACCCTATATAAACCGCCGAGCCCTAGTCTCTGTTTGCAATTTCTACAATTCAATCGTCAACCCTATCTTCTCTATATTTTCCCCCAATATGGACCCCGATGATGCACCACAACCAGAATTCGATCCACGTGTGCCCTCCAC...

CDS

Download CDS FASTA

2487 bp · LXL04_012197|LXL04_012197|OH1004|CDS

CTGGTGAAGTCCCCTTCTTATATGTTTAATCTCCTTCGACCCTATATAAACCGCCGAGCCCTAGTCTCTGTTTGCAATTTCTACAATTCAATCGTCAACCCTATCTTCTCTATATTTTCCCCCAATATGGACCCCGATGATGCACCACAACCAGAATTCGATCCACGTGTGCCCTCCACACCCGTCTCCTACCCAATCAAAACCTTAGAAGACTTAAAACTTCGTACATACTTTGATTCTTTCCATTTCCAGTTCAACAA...

Protein

Download Protein FASTA

828 aa · LXL04_012197|LXL04_012197|OH1004|PROTEIN

MVKSPSYMFNLLRPYINRRALVSVCNFYNSIVNPIFSIFSPNMDPDDAPQPEFDPRVPSTPVSYPIKTLEDLKLRTYFDSFHFQFNKASVSLSRSGVDDASLPNRRRIMACHDMQGGYTDDKWIQGGSNADAYSIWHWYLMDVFIYFSHNLVTLPPPGWVNAAHKHGVKVLGTFIVEWGEGSLIADQFLATTTAAHMYAERLSELAGALGFDGWLINMEVSLDTARIPTLKEFVSHLTQVMHSSVPGSLVIWYDSVTTEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012197`
TK1151 ID	TkA02G582230
OH-1004 ID	LXL04_012197
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 96.801 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012197

Location Chr03:8179298-8183304 (+)

Description Similar to ENGASE2: Cytosolic endo-beta-N-acetylglucosaminidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11040`	Endoglycosidase that releases N-glycans from glycoproteins by cleaving the beta-1,4-glycosidic bond in the N,N'-diacetylchitobiose core.	The two endo-β-N-acetylglucosaminidase genes from Arabidopsis thaliana encode cytoplasmic enzymes controlling free N-glycan levels.2011 · DOI: 10.1007/s11103-011-9808-7
`At5g05460`	Endoglycosidase that releases N-glycans from glycoproteins by cleaving the beta-1,4-glycosidic bond in the N,N'-diacetylchitobiose core.	The two endo-β-N-acetylglucosaminidase genes from Arabidopsis thaliana encode cytoplasmic enzymes controlling free N-glycan levels.2011 · DOI: 10.1007/s11103-011-9808-7

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012197 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006491 N-glycan processing Biological Process

GO:0006517 protein deglycosylation Biological Process

GO:0005615 extracellular space Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016231 beta-N-acetylglucosaminidase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0033925 mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G05460

hsa:64772

mmu:217364

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.378

Rank 1 · LXL04_012197 · OH-1004

Nucleus0.205

Rank 2 · LXL04_012197 · OH-1004

Endoplasmic reticulum0.150

Rank 3 · LXL04_012197 · OH-1004

Cell membrane0.128

Rank 4 · LXL04_012197 · OH-1004

Lysosome / Vacuole0.102

Rank 5 · LXL04_012197 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03644.20Glyco_hydro_85118-395 aa

PF25529.2Ig_ENGASE1_C598-705 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012197	`PF03644.20`	Glyco_hydro_85	118	395	2.9e-101	339.6
LXL04_012197	`PF25529.2`	Ig_ENGASE1_C	598	705	1.3e-24	87.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRL4`	Arabidopsis thaliana	Cytosolic endo-beta-N-acetylglucosaminidase 2	49.020%	Swiss-Prot	moderate database homology
`F4JZC2`	Arabidopsis thaliana	Cytosolic endo-beta-N-acetylglucosaminidase 1	52.104%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card