TkA02G579000 | RubberDandelionOmics

Gene overview

TkA02G579000

Reference: TK1151 Chr: Chr02 Coordinates: 149365427-149371784 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4215 bp · TkA02G579000|TK1151|cDNA

AAACTGCACCATTTAAAAAAAAAAAAAAATCTTTGCATGGTTGGTAAAAACCAAGTGGAACACCGTCAAGGAAAACAATATTCTAATCACCAAAAATCCAAAATTACAATGGATACCTTGAGATGAGTCCACGCTACTTTCACCTCATTTCATGCTTCTTCTTCAATGTTCTTCGTATCCTCCAAATCCTAAGCAAACCAAACAACGACAAAGAAAAAGAAAGCCCTAGCTTTTAAGATGAGCGAAATCAAAGAAGCGTT...

CDS

Download CDS FASTA

2790 bp · TkA02G579000|TK1151|CDS

ATGACCATTGACCAGTCATACGATAAGTATGATCGCGGTTTTATTTGTGAAGGTTGGCTAGGTTCTGGTTATCGTCCAATTACGATGAACTGGAACAAGAATACAGACTGTTTCAAGTGGGATGGTATCACTTGCAACCACTTAACCGGTGATGTTATTGGTATTGACCTCAGTTGTGGAATGCTACAAGGTACCATCCACCCAAACACCACCCTCTTTCACCTTCCTCATCTCCAAACACTCAACCTTGCTTTCAATAA...

Protein

Download Protein FASTA

929 aa · TkA02G579000|TK1151|PROTEIN

MTIDQSYDKYDRGFICEGWLGSGYRPITMNWNKNTDCFKWDGITCNHLTGDVIGIDLSCGMLQGTIHPNTTLFHLPHLQTLNLAFNKFSRFQLPRNIGGLSNSLTLLNLSKCGFSGDIPGEILYLPKLVTLDLSGNDGLQLQPSILKNLLLNSTHLRELLLKYVDISWVLPRYLNISTSLKSLDLSNTILQGKLPDNIFGLHYLEKLDMSNNDDITGPLPSVNKSNNIPLKWLDLSNANLSGEIPESVGHLKSLNYLDIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G579000`
TK1151 ID	TkA02G579000
OH-1004 ID	LXL04_012243
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.000
Protein coverage (%)	TK1151 95.910 / OH-1004 87.210 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G579000

Location Chr02:149365427-149371784 (+)

Description Similar to RLP6: Receptor-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g45616`	Receptor-like protein 6.	No verified direct reference in this release
`At2g32660`	Receptor like protein 22.	No verified direct reference in this release
`At3g25020`	Recognizes fungal (e.g. B.cinerea and A.niger) endopolygalacturonases (PGs, e.g.	Fungal endopolygalacturonases are recognized as microbe-associated molecular patterns by the arabidopsis receptor-like protein RESPONSIVENESS TO BOTRYTIS POLYGALACTURONASES1.2014 · DOI: 10.1104/pp.113.230698
`At5g40170`	Receptor-like protein 54.	No verified direct reference in this release
`At3g24900`	Receptor-like protein 39.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012243 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0051707 response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G45616

ath:AT1G47890

ath:AT2G15080

ath:AT3G11010

ath:AT3G11080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.853

Rank 1 · TkA02G579000 · TK1151

Endoplasmic reticulum0.093

Rank 2 · TkA02G579000 · TK1151

Cytoplasm0.063

Rank 3 · TkA02G579000 · TK1151

Nucleus0.042

Rank 4 · TkA02G579000 · TK1151

Lysosome / Vacuole0.030

Rank 5 · TkA02G579000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_228-46 aa

PF23211LRR_LRWD163-142 aa

PF13855LRR_870-112 aa

PF23598LRR_1471-149 aa

PF23286LRR_1372-119 aa

PF12799LRR_474-90 aa

PF13516LRR_674-88 aa

PF24048LRR_NXF1-575-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G579000	`PF08263`	LRRNT_2	28	46	0.08	13.9
TkA02G579000	`PF23211`	LRR_LRWD1	63	142	2.1e-08	34.8
TkA02G579000	`PF13855`	LRR_8	70	112	3.2e-60	200.5
TkA02G579000	`PF23598`	LRR_14	71	149	1.9e-35	123.0
TkA02G579000	`PF23286`	LRR_13	72	119	9e-05	23.0
TkA02G579000	`PF12799`	LRR_4	74	90	3.8e-52	173.8
TkA02G579000	`PF13516`	LRR_6	74	88	1.1e-18	66.4
TkA02G579000	`PF24048`	LRR_NXF1-5	75	111	0.041	14.2
TkA02G579000	`PF24758`	LRR_At5g56370	76	190	5.2e-12	46.6
TkA02G579000	`PF25019`	LRR_R13L1-DRL21	76	134	0.0051	17.4
TkA02G579000	`PF00560`	LRR_1	77	99	1.4e-65	203.6
TkA02G579000	`PF29594`	LRR_SKP2	77	186	0.0015	18.5
TkA02G579000	`PF13516`	LRR_6	101	116	1.1e-18	66.4
TkA02G579000	`PF13855`	LRR_8	102	137	3.2e-60	200.5
TkA02G579000	`PF00560`	LRR_1	103	123	1.4e-65	203.6
TkA02G579000	`PF12799`	LRR_4	103	137	3.8e-52	173.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C637`	Arabidopsis thaliana	sp\|Q9C637\|RLP6_ARATH Receptor-like protein 6	38.100%	Swiss-Prot	Low
`O48851`	Arabidopsis thaliana	sp\|O48851\|RLP22_ARATH Receptor like protein 22	45.900%	Swiss-Prot	Low
`Q9LJS0`	Arabidopsis thaliana	sp\|Q9LJS0\|RLP42_ARATH Receptor-like protein 42	39.800%	Swiss-Prot	Low
`F4KHA2`	Arabidopsis thaliana	sp\|F4KHA2\|RLP54_ARATH Receptor-like protein 54	47.800%	Swiss-Prot	Low
`F4J7T6`	Arabidopsis thaliana	sp\|F4J7T6\|RLP39_ARATH Receptor-like protein 39	39.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card