TkA02G578610 | RubberDandelionOmics

Gene overview

TkA02G578610

Reference: TK1151 Chr: Chr02 Coordinates: 149256363-149258663 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

975 bp · TkA02G578610|TK1151|cDNA

ATGTGTCGCTATTGACATAAGAACACAATTCATTGCCTCCAAACGAATAGCGAACACCCCTCCTCTTGTTCTCCTTCTCCGATCGGTAGACGCCGGCGCAAGCTCCCCCCCGCCCGAAACGCCGCGCTGACGCTGGTTTTTCTCTCGCCGGCAGTTGATTTTCCTGTCGCTGGTCGCTTGGAACCGCTGCAACCAGTCGCGTGTCCTTCTTCTTCTTCCAGTCGCCATCAGCAGCTCCACCGGGACAACCACCAGAAAAT...

CDS

Download CDS FASTA

477 bp · TkA02G578610|TK1151|CDS

ATGGCGGAGAAACTGGCACCTGAGAAACGCCACAGCTTTTTCCATGGAAGTCAGAAGGTTTTTGAATGGGATCAAACTCTAGATGAAGTAAATATGTACATCACTTTGCCTAAAGAAGTTCCCACCAAGCTCTTTTACTGCAAAGTTCAATCCAAACACGTTCAAGTTGGAATCGAAGGCAATCCTCCATATTTGAATCATGATTTATCGTCACCTGTGAAAACAGATTCTTCATTTTGGACCATAGAGGATGACACATT...

Protein

Download Protein FASTA

158 aa · TkA02G578610|TK1151|PROTEIN

MAEKLAPEKRHSFFHGSQKVFEWDQTLDEVNMYITLPKEVPTKLFYCKVQSKHVQVGIEGNPPYLNHDLSSPVKTDSSFWTIEDDTLHITLQKRDKGQTWSSPIQGQGQLDPLAADLEQKRLMLQRFQEENPGFDFSQAQFSGNCPDPRTFMGGIKSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G578610`
TK1151 ID	TkA02G578610
OH-1004 ID	LXL04_012247
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.300
Protein coverage (%)	TK1151 89.241 / OH-1004 72.308 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G578610`
Location	Chr02:149256363-149258663 (+)
Description	Similar to Nudcd2: NudC domain-containing protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012247` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0006950 response to stress Biological Process GO:0009408 response to heat Biological Process GO:0009555 pollen development Biological Process GO:0009880 embryonic pattern specification Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0010286 heat acclimation Biological Process GO:0010450 inflorescence meristem growth Biological Process GO:0032502 developmental process Biological Process GO:0048448 stamen morphogenesis Biological Process GO:0048461 flower structural organization Biological Process GO:0048833 specification of floral organ number Biological Process
KEGG gene cross-reference	ath:AT4G27890 ath:AT5G53400 hsa:134492 mmu:52653 rno:287199 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.642

Rank 1 · TkA02G578610 · TK1151

Nucleus0.497

Rank 2 · TkA02G578610 · TK1151

Mitochondrion0.101

Rank 3 · TkA02G578610 · TK1151

Cell membrane0.098

Rank 4 · TkA02G578610 · TK1151

Endoplasmic reticulum0.065

Rank 5 · TkA02G578610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04969CS21-93 aa

PF21413SHQ1-like_CS21-100 aa

PF21413SHQ1-like_CS127-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G578610	`PF04969`	CS	21	93	7.3e-20	72.4
TkA02G578610	`PF21413`	SHQ1-like_CS	21	100	0.2	12.4
TkA02G578610	`PF21413`	SHQ1-like_CS	127	137	0.2	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card