RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G573630
Reference: TK1151 Chr: Chr02 Coordinates: 148151669-148153764 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1575 bp · TkA02G573630|TK1151|cDNA

ATGATCACTAATGAAGTACTTCTAAGCTCATGGAACACTTCCGTTCATTTCTGTGATTGGAGTGGTGTTTCATGTGGGAAGCGCCACAGAAGAGTCACTGCTCTACAAGGCCTAGAAGGATCATTGTCTCCTCATGTAGGCAACCTCAGCAGCTTCCTTCGTGAACTTTATCTCACCAACAACAGCTTTCAAGGAACGATCCGTCAAGAACTCGGCCGTCTTACCAGGTTACGCGTCCTCGATCTTGGCCGTAACAGGTT...

CDS

Download CDS FASTA

1575 bp · TkA02G573630|TK1151|CDS

ATGATCACTAATGAAGTACTTCTAAGCTCATGGAACACTTCCGTTCATTTCTGTGATTGGAGTGGTGTTTCATGTGGGAAGCGCCACAGAAGAGTCACTGCTCTACAAGGCCTAGAAGGATCATTGTCTCCTCATGTAGGCAACCTCAGCAGCTTCCTTCGTGAACTTTATCTCACCAACAACAGCTTTCAAGGAACGATCCGTCAAGAACTCGGCCGTCTTACCAGGTTACGCGTCCTCGATCTTGGCCGTAACAGGTT...

Protein

Download Protein FASTA

524 aa · TkA02G573630|TK1151|PROTEIN

MITNEVLLSSWNTSVHFCDWSGVSCGKRHRRVTALQGLEGSLSPHVGNLSSFLRELYLTNNSFQGTIRQELGRLTRLRVLDLGRNRFDGVIPTNLSRCANFNDLRLDFNKLVGSVPKEMSFLSKLTFLSLRTNMLTGGIPPMLGNITSMEVFSAVENPLGGSIPDTLGRWRSLRGLGFGGCNLSGTIPDSIYNLSRLANFSLAGNQLAGSLPSDLGFPNCEATRKHKKRKVQPSQSSTSTNESFVKVSYGQLLKATNGFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G573630
TK1151 IDTkA02G573630
OH-1004 IDLXL04_012321
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)64.100
Protein coverage (%)TK1151 59.542 / OH-1004 10.951
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G573630
LocationChr02:148151669-148153764 (-)
DescriptionSimilar to At3g47570: Probable LRR receptor-like serine/threonine-protein kinase At3g47570
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g47570 Probable LRR receptor-like serine/threonine-protein kinase At3g47570. No verified direct reference in this release
At3g47110 Putative receptor-like protein kinase At3g47110. No verified direct reference in this release
At5g20480 Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs); phosphorylates BIK1 upon elicitation to regulate immune responses such as defense hormone expression (e.g. jasmonic acid (JA) and salicylic acid (SA)). No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: Q1MX30 Receptor kinase that detects X.oryzae pv. oryzae protein Ax21 to promote innate immunity. No verified direct reference in this release
Os11g0569733 Receptor kinase that detects X.oryzae pv. oryzae protein Ax21 to promote innate immunity.
Cleavage and nuclear localization of the rice XA21 immune receptor.2012 · DOI: 10.1038/ncomms1932
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012321 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009617 response to bacterium Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT3G47570
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.829
Rank 1 · TkA02G573630 · TK1151
Cytoplasm0.093
Rank 2 · TkA02G573630 · TK1151
Nucleus0.071
Rank 3 · TkA02G573630 · TK1151
Endoplasmic reticulum0.068
Rank 4 · TkA02G573630 · TK1151
Lysosome / Vacuole0.019
Rank 5 · TkA02G573630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_26-25 aa
PF08263LRRNT_233-51 aa
PF10707YrbL-PhoP_reg47-75 aa
PF23598LRR_1451-176 aa
PF00560LRR_153-74 aa
PF13855LRR_853-111 aa
PF12799LRR_453-86 aa
PF00560LRR_176-98 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G573630PF08263LRRNT_26250.0002621.9
TkA02G573630PF08263LRRNT_233510.0002621.9
TkA02G573630PF10707YrbL-PhoP_reg47750.1312.6
TkA02G573630PF23598LRR_14511762e-0627.5
TkA02G573630PF00560LRR_153742.8e-1553.9
TkA02G573630PF13855LRR_8531113.7e-0936.9
TkA02G573630PF12799LRR_453861.4e-0835.4
TkA02G573630PF00560LRR_176982.8e-1553.9
TkA02G573630PF13855LRR_8761353.7e-0936.9
TkA02G573630PF00560LRR_11031202.8e-1553.9
TkA02G573630PF12799LRR_41041341.4e-0835.4
TkA02G573630PF00560LRR_11241452.8e-1553.9
TkA02G573630PF12799LRR_41241531.4e-0835.4
TkA02G573630PF00560LRR_11511692.8e-1553.9
TkA02G573630PF13855LRR_81652073.7e-0936.9
TkA02G573630PF23598LRR_141662132e-0627.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGP4Arabidopsis thalianasp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g4757043.000%Swiss-ProtMedium
Q9SD62Arabidopsis thalianasp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g4711040.200%Swiss-ProtMedium
C0LGT6Arabidopsis thalianasp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR39.200%Swiss-ProtMedium
Q1MX30Oryza sativa subsp. indicasp|Q1MX30|XA21_ORYSI Receptor kinase-like protein Xa2144.200%Swiss-ProtMedium
Q2R2D5Oryza sativa subsp. japonicasp|Q2R2D5|XA21_ORYSJ Receptor kinase-like protein Xa2144.200%Swiss-ProtMedium

JBrowse

View in Genome Browser