TkA02G572230 | RubberDandelionOmics

Gene overview

TkA02G572230

Reference: TK1151 Chr: Chr02 Coordinates: 147743073-147745605 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1748 bp · TkA02G572230|TK1151|cDNA

ATCGCATGCTTTCAACTCTCTCAAGTTCGTTTTCTGAATCACAATTCCATAATTCCATTTCCATGAATGAACGCACACAGGCAAAGTTGTTACATATCCACATAACATGCTGTAATCTGTATTTGTCCGAGTAAACCTTGCTTTAGTGTGTGTGTTTTCACACAGTTCACGGTGGTGCTAATCGGATCTCCATAATCGATTAATCTCCATTTCCATTCGCTTTTCTGTTCAGATTTGTTTCAATCATACACAGTTGCTTT...

CDS

Download CDS FASTA

768 bp · TkA02G572230|TK1151|CDS

ATGGTTTCAAGCGGGATTTGTTCTGACGACTGGTATCAACAGTGCTTATGTGCTTGGATACTCGGGTGCGATCATGGTTCCTCTTGGTTGGGTAGGTGGAGTTGTAGGTTTAATTTAGCCACACTTATATCACTATACGCAAATGTTTTAATCGCAAGGCTCCATGAATTTGGTGGGAAGAGGCATATCAGATATAGAGATCTTGCAGGCTTTGTGTATGGTCCAAAAGCTTATTCTCTTACATGGGTGTTACAATATGT...

Protein

Download Protein FASTA

255 aa · TkA02G572230|TK1151|PROTEIN

MVSSGICSDDWYQQCLCAWILGCDHGSSWLGRWSCRFNLATLISLYANVLIARLHEFGGKRHIRYRDLAGFVYGPKAYSLTWVLQYVNLFMINVGYIMLAGQALKAIYIIFKDDNVMKLPFFITLAGFTCGIFAICIPHLSALRVWLGVSTFLTIVYIVAVVALSLRDGIQAPPRDYSIPGTDTSKIFTTIGASASLVFAFNTGMLPEIQATVRPPVVSNMMKALYFQFSVGVLPLYAVVFGGIGLMAMMHLLIC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G572230`
TK1151 ID	TkA02G572230
OH-1004 ID	LXL04_012306
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 80.392 / OH-1004 46.171 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G572230

Location Chr02:147743073-147745605 (+)

Description Similar to PROT1: Proline transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39890`	Proline transporter that mediates proline and glycine betaine transport.	The AtProT family. Compatible solute transporters with similar substrate specificity but differential expression patterns.2005 · DOI: 10.1104/pp.104.055079 Salt stress-induced proline transporters and salt stress-repressed broad specificity amino acid permeases identified by suppression of a yeast amino acid permease-targeting mutant.1996 · DOI: 10.1105/tpc.8.8.1437
`At2g36590`	Proline transporter that mediates proline and glycine betaine transport.	The AtProT family. Compatible solute transporters with similar substrate specificity but differential expression patterns.2005 · DOI: 10.1104/pp.104.055079
`At3g55740`	Proline transporter that mediates proline and glycine betaine transport.	Identification and characterization of GABA, proline and quaternary ammonium compound transporters from Arabidopsis thaliana.1999 · DOI: 10.1016/s0014-5793(99)00516-5 The AtProT family. Compatible solute transporters with similar substrate specificity but differential expression patterns.2005 · DOI: 10.1104/pp.104.055079 In planta function of compatible solute transporters of the AtProT family.2011 · DOI: 10.1093/jxb/erq320 Salt stress-induced proline transporters and salt stress-repressed broad specificity amino acid permeases identified by suppression of a yeast amino acid permease-targeting mutant.1996 · DOI: 10.1105/tpc.8.8.1437

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q69LA1`	Proline transporter that mediates proline transport across the plasma membrane.	No verified direct reference in this release
`Os03g0644400`	Proline transporter that mediates proline transport across the plasma membrane when expressed in a heterologous system (Xenopus oocytes).	Molecular cloning and characterization of a cDNA encoding proline transporter in rice.2000 · DOI: 10.1093/pcp/41.6.750

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012306 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0015824 proline transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015193 L-proline transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G36590

ath:AT2G39890

ath:AT3G55740

dosa:Os03g0644400

dosa:Os07g0100800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.432

Rank 1 · TkA02G572230 · TK1151

Lysosome / Vacuole0.273

Rank 2 · TkA02G572230 · TK1151

Endoplasmic reticulum0.165

Rank 3 · TkA02G572230 · TK1151

Cytoplasm0.134

Rank 4 · TkA02G572230 · TK1151

Golgi apparatus0.102

Rank 5 · TkA02G572230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490Aa_trans39-239 aa

PF18169SLATT_6114-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G572230	`PF01490`	Aa_trans	39	239	8.3e-35	120.9
TkA02G572230	`PF18169`	SLATT_6	114	188	0.036	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92961`	Arabidopsis thaliana	sp\|P92961\|PROT1_ARATH Proline transporter 1	72.700%	Swiss-Prot	High
`Q9SJP9`	Arabidopsis thaliana	sp\|Q9SJP9\|PROT3_ARATH Proline transporter 3	71.200%	Swiss-Prot	High
`P92962`	Arabidopsis thaliana	sp\|P92962\|PROT2_ARATH Proline transporter 2	70.700%	Swiss-Prot	High
`Q69LA1`	Oryza sativa subsp. japonica	sp\|Q69LA1\|PROT2_ORYSJ Probable proline transporter 2	62.200%	Swiss-Prot	High
`Q60DN5`	Oryza sativa subsp. japonica	sp\|Q60DN5\|PROT1_ORYSJ Proline transporter 1	67.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card