LXL04_012306 | RubberDandelionOmics

Gene overview

LXL04_012306

Reference: OH-1004 Chr: Chr03 Coordinates: 10053105-10055240 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1335 bp · LXL04_012306|LXL04_012306|OH1004|cDNA

ATGGACGTACAAAGAGACGAAGCTGTTCCTGGTGGCCCATGGAAGATACACTCCGACGATCATTTAGCCATTGAAATCCCTGAAACAGCCCATAAGATCAGCAGCGACTCATGGTTTCAAGCGGGATTTGTTCTGACGACTGGTATCAACAGTGCTTATGTGCTTGGATACTCGGGTGCGATCATGGTTCCTCTTGGATGGGTAGGTGGAGTTACAGGTTTAATTTTAGCCACACTTATATCACTATACGCAAATATTTT...

CDS

Download CDS FASTA

1335 bp · LXL04_012306|LXL04_012306|OH1004|CDS

ATGGACGTACAAAGAGACGAAGCTGTTCCTGGTGGCCCATGGAAGATACACTCCGACGATCATTTAGCCATTGAAATCCCTGAAACAGCCCATAAGATCAGCAGCGACTCATGGTTTCAAGCGGGATTTGTTCTGACGACTGGTATCAACAGTGCTTATGTGCTTGGATACTCGGGTGCGATCATGGTTCCTCTTGGATGGGTAGGTGGAGTTACAGGTTTAATTTTAGCCACACTTATATCACTATACGCAAATATTTT...

Protein

Download Protein FASTA

444 aa · LXL04_012306|LXL04_012306|OH1004|PROTEIN

MDVQRDEAVPGGPWKIHSDDHLAIEIPETAHKISSDSWFQAGFVLTTGINSAYVLGYSGAIMVPLGWVGGVTGLILATLISLYANILIARLHEFGGKRHIRYRDLAGFVYGPKAYSLTWVLQYVNLFMINVGYIMLAGQALKAIYIIFKDDNVMKLPFFITIAGFTCGIFAICIPHLSALRVWLGVSTFLTVVYIVAVVALSLRDGIQAPPRDYSIPGTDTSKIFTTIGASASLVFAFNTGMLPEIQATVRPPVVSNMMK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012306`
TK1151 ID	TkA02G572230
OH-1004 ID	LXL04_012306
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 80.392 / OH-1004 46.171 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012306

Location Chr03:10053105-10055240 (-)

Description Similar to PROT1: Proline transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39890`	Proline transporter that mediates proline and glycine betaine transport.	The AtProT family. Compatible solute transporters with similar substrate specificity but differential expression patterns.2005 · DOI: 10.1104/pp.104.055079 Salt stress-induced proline transporters and salt stress-repressed broad specificity amino acid permeases identified by suppression of a yeast amino acid permease-targeting mutant.1996 · DOI: 10.1105/tpc.8.8.1437
`At3g55740`	Proline transporter that mediates proline and glycine betaine transport.	Identification and characterization of GABA, proline and quaternary ammonium compound transporters from Arabidopsis thaliana.1999 · DOI: 10.1016/s0014-5793(99)00516-5 The AtProT family. Compatible solute transporters with similar substrate specificity but differential expression patterns.2005 · DOI: 10.1104/pp.104.055079 In planta function of compatible solute transporters of the AtProT family.2011 · DOI: 10.1093/jxb/erq320 Salt stress-induced proline transporters and salt stress-repressed broad specificity amino acid permeases identified by suppression of a yeast amino acid permease-targeting mutant.1996 · DOI: 10.1105/tpc.8.8.1437
`At2g36590`	Proline transporter that mediates proline and glycine betaine transport.	The AtProT family. Compatible solute transporters with similar substrate specificity but differential expression patterns.2005 · DOI: 10.1104/pp.104.055079

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q69LA1`	Proline transporter that mediates proline transport across the plasma membrane.	No verified direct reference in this release
`Os03g0644400`	Proline transporter that mediates proline transport across the plasma membrane when expressed in a heterologous system (Xenopus oocytes).	Molecular cloning and characterization of a cDNA encoding proline transporter in rice.2000 · DOI: 10.1093/pcp/41.6.750

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012306 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0015824 proline transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015193 L-proline transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G36590

ath:AT2G39890

ath:AT3G55740

dosa:Os03g0644400

dosa:Os07g0100800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.785

Rank 1 · LXL04_012306 · OH-1004

Cytoplasm0.102

Rank 2 · LXL04_012306 · OH-1004

Lysosome / Vacuole0.084

Rank 3 · LXL04_012306 · OH-1004

Endoplasmic reticulum0.074

Rank 4 · LXL04_012306 · OH-1004

Golgi apparatus0.039

Rank 5 · LXL04_012306 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490.25Aa_trans36-427 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012306	`PF01490.25`	Aa_trans	36	427	3.5e-80	270.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92961`	Arabidopsis thaliana	Proline transporter 1	72.535%	Swiss-Prot	strong database homology
`P92962`	Arabidopsis thaliana	Proline transporter 2	70.233%	Swiss-Prot	strong database homology
`Q9SJP9`	Arabidopsis thaliana	Proline transporter 3	71.971%	Swiss-Prot	strong database homology
`Q69LA1`	Oryza sativa subsp. japonica	Probable proline transporter 2	68.765%	Swiss-Prot	strong database homology
`Q60DN5`	Oryza sativa subsp. japonica	Proline transporter 1	65.914%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card