TkA02G571550 | RubberDandelionOmics

Gene overview

TkA02G571550

Reference: TK1151 Chr: Chr02 Coordinates: 147582945-147585235 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1325 bp · TkA02G571550|TK1151|cDNA

GTAACTTCGGGGTTCGTTTTGCCAAATTACTATAACAATATCACCTGGCTTGACCACCGGTTCAAGCGACCGCAACCTAAGTTTAATCGCCGGTCCGGAAAGCTCGCAATGGCTGATGATGGTGATTTGCTGTGGAGCTCTTCCACAGATCGAAGCTCAGAAGTTCAATTGTTCGACCGAGATCGACACATAATGTATTTGGAGATGAACTACCAGCTATTGCCATCACCGTATGAGGGTCAAGAGATCAATCGTCTTAC...

CDS

Download CDS FASTA

1056 bp · TkA02G571550|TK1151|CDS

ATGGCTGATGATGGTGATTTGCTGTGGAGCTCTTCCACAGATCGAAGCTCAGAAGTTCAATTGTTCGACCGAGATCGACACATAATGTATTTGGAGATGAACTACCAGCTATTGCCATCACCGTATGAGGGTCAAGAGATCAATCGTCTTACTCTCGCTTACTTTATCATTTCGGGTCTTCACATCCTGCATGCAGAAGATCGTGTTGATAAAGAAGCTGTAATCAATTGGGTTTTGTCATTGCAAGCTCATCCTAAAAC...

Protein

Download Protein FASTA

351 aa · TkA02G571550|TK1151|PROTEIN

MADDGDLLWSSSTDRSSEVQLFDRDRHIMYLEMNYQLLPSPYEGQEINRLTLAYFIISGLHILHAEDRVDKEAVINWVLSLQAHPKTEAELNNGQFYGFHGSRSSQFHSPDNAVSVPNNSHLASTYCALAILKTVGYDFSLIDSSSILKSMKCLQQSDGRGRNGFTPLNLSAVISSLLDDWSGMDKEKAKDYILSCQSYDGGFGLIPGQESHGGATYCAVASLRLMGFIEDELSLSLSKSSSIIDVQLLLDWCLQRQAVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G571550`
TK1151 ID	TkA02G571550
OH-1004 ID	LXL04_030711
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.900
Protein coverage (%)	TK1151 50.997 / OH-1004 87.685 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G571550

Location Chr02:147582945-147585235 (+)

Description Similar to GGB: Geranylgeranyl transferase type-1 subunit beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39550`	Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X (CaaX).	No verified direct reference in this release
`At5g40280`	Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic- aliphatic-X (CaaX).	The CaaX specificities of Arabidopsis protein prenyltransferases explain era1 and ggb phenotypes.2010 · DOI: 10.1186/1471-2229-10-118 ASG2 is a farnesylated DWD protein that acts as ABA negative regulator in Arabidopsis.2016 · DOI: 10.1111/pce.12605

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030711 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0018344 protein geranylgeranylation Biological Process

GO:0045787 positive regulation of cell cycle Biological Process

GO:0080120 CAAX-box protein maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005953 CAAX-protein geranylgeranyltransferase complex Cellular Component

GO:0004661 protein geranylgeranyltransferase activity Molecular Function

GO:0004662 CAAX-protein geranylgeranyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G39550

bta:509322

hsa:5229

mmu:225467

rno:81746

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.722

Rank 1 · TkA02G571550 · TK1151

Nucleus0.368

Rank 2 · TkA02G571550 · TK1151

Mitochondrion0.079

Rank 3 · TkA02G571550 · TK1151

Peroxisome0.076

Rank 4 · TkA02G571550 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA02G571550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00432Prenyltrans22-342 aa

PF13249SQHop_cyclase_N179-235 aa

PF28705DMAC2_N245-258 aa

PF13249SQHop_cyclase_N282-331 aa

PF28705DMAC2_N288-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G571550	`PF00432`	Prenyltrans	22	342	1.4e-87	294.6
TkA02G571550	`PF13249`	SQHop_cyclase_N	179	235	4.1e-06	26.9
TkA02G571550	`PF28705`	DMAC2_N	245	258	0.18	12.4
TkA02G571550	`PF13249`	SQHop_cyclase_N	282	331	4.1e-06	26.9
TkA02G571550	`PF28705`	DMAC2_N	288	303	0.18	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80642`	Arabidopsis thaliana	sp\|O80642\|PGTB1_ARATH Geranylgeranyl transferase type-1 subunit beta	63.500%	Swiss-Prot	High
`Q38920`	Arabidopsis thaliana	sp\|Q38920\|FNTB_ARATH Protein farnesyltransferase subunit beta	30.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card