TkA02G567580 | RubberDandelionOmics

Gene overview

TkA02G567580

Reference: TK1151 Chr: Chr02 Coordinates: 146636397-146641409 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2247 bp · TkA02G567580|TK1151|cDNA

AATAGTCAAAGTCAAAAACCCAAGCGAAACGTCAATAAAACGATAACGCCCACTTCAGTACAAATCGAAAAATCCTTTCCCATATCTTTTTCCAAAATCAAACATTTCCCACTCTTTTCAAACATGGCGGCCAAAGCCACAATTACTATTACGCTCACGGTGGCGCTAATTTTAATGACGGCGGATTTCGCCACCTCCGCCACCCGCTGCCCTGACTGTGGCTCCACACAAGTTCCGTACCCACTCAGCACCGGACCTAG...

CDS

Download CDS FASTA

2040 bp · TkA02G567580|TK1151|CDS

AATAGTCAAAGTCAAAAACCCAAGCGAAACGTCAATAAAACGATAACGCCCACTTCAGTACAAATCGAAAAATCCTTTCCCATATCTTTTTCCAAAATCAAACATTTCCCACTCTTTTCAAACATGGCGGCCAAAGCCACAATTACTATTACGCTCACGGTGGCGCTAATTTTAATGACGGCGGATTTCGCCACCTCCGCCACCCGCTGCCCTGACTGTGGCTCCACACAAGTTCCGTACCCACTCAGCACCGGACCTAG...

Protein

Download Protein FASTA

679 aa · TkA02G567580|TK1151|PROTEIN

NSQSQKPKRNVNKTITPTSVQIEKSFPISFSKIKHFPLFSNMAAKATITITLTVALILMTADFATSATRCPDCGSTQVPYPLSTGPSCGDQSYRIRCDANAGALYFNSINNTYSISSISQATQRFVIRPPSFLNNNTTCVTADISSQGLQLDPNLPFNITSGNTILYLNCSESLLRSPLNCTSTSLCHTYINNSAEASACGRAPLCCTFRTGGSSTMYSIRVRDGGCQAYRSFPNLDYSLPVSRWPAAGVEIQWVSPPEP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G567580`
TK1151 ID	TkA02G567580
OH-1004 ID	LXL04_012392
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.600
Protein coverage (%)	TK1151 93.814 / OH-1004 99.846 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G567580

Location Chr02:146636397-146641409 (-)

Description Similar to WAKL20: Wall-associated receptor kinase-like 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02070`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At3g53840`	Putative serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21270`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21230`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21240`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012392 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0048527 lateral root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G21210

ath:AT1G21230

ath:AT1G21240

ath:AT3G53840

ath:AT5G02070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.873

Rank 1 · TkA02G567580 · TK1151

Cytoplasm0.084

Rank 2 · TkA02G567580 · TK1151

Endoplasmic reticulum0.072

Rank 3 · TkA02G567580 · TK1151

Nucleus0.053

Rank 4 · TkA02G567580 · TK1151

Extracellular0.026

Rank 5 · TkA02G567580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947GUB_WAK_bind70-127 aa

PF13947GUB_WAK_bind178-188 aa

PF12301CD99L2303-346 aa

PF21314TM_ErbB1321-349 aa

PF18181SLATT_1326-378 aa

PF03109ABC1376-438 aa

PF00069Pkinase387-656 aa

PF07714PK_Tyr_Ser-Thr389-657 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G567580	`PF13947`	GUB_WAK_bind	70	127	3.8e-08	34.3
TkA02G567580	`PF13947`	GUB_WAK_bind	178	188	3.8e-08	34.3
TkA02G567580	`PF12301`	CD99L2	303	346	0.032	15.3
TkA02G567580	`PF21314`	TM_ErbB1	321	349	0.26	11.8
TkA02G567580	`PF18181`	SLATT_1	326	378	0.23	12.2
TkA02G567580	`PF03109`	ABC1	376	438	0.0009	19.2
TkA02G567580	`PF00069`	Pkinase	387	656	1.3e-44	153.3
TkA02G567580	`PF07714`	PK_Tyr_Ser-Thr	389	657	1.8e-47	162.6
TkA02G567580	`PF03109`	ABC1	499	534	0.0009	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZM4`	Arabidopsis thaliana	sp\|Q9LZM4\|WAKLQ_ARATH Wall-associated receptor kinase-like 20	56.800%	Swiss-Prot	High
`Q9M342`	Arabidopsis thaliana	sp\|Q9M342\|WAKLP_ARATH Wall-associated receptor kinase-like 15	50.700%	Swiss-Prot	High
`Q9LMP1`	Arabidopsis thaliana	sp\|Q9LMP1\|WAK2_ARATH Wall-associated receptor kinase 2	42.000%	Swiss-Prot	Medium
`Q9LMN7`	Arabidopsis thaliana	sp\|Q9LMN7\|WAK5_ARATH Wall-associated receptor kinase 5	42.100%	Swiss-Prot	Medium
`Q9LMN8`	Arabidopsis thaliana	sp\|Q9LMN8\|WAK3_ARATH Wall-associated receptor kinase 3	38.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card