LXL04_012392 | RubberDandelionOmics

Gene overview

LXL04_012392

Reference: OH-1004 Chr: Chr03 Coordinates: 11531315-11535277 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2071 bp · LXL04_012392|LXL04_012392|OH1004|cDNA

AATAGTCAAGTCAAAAACCCAAGCAAATCGTCAATAAAACGATAACGACCACTTCAGTACAAATCGAAAAATCCTTCCCATATCTTTTTCCAAAATCAAACATTTTTCACTCTTTTCAAACATGGCGGCCAAAGCCACAATTACTATTATGCTCGCGGTGGCGCTGATTTTAATGACGGCGGATTTCGCCACCTCCGCCACCCGCTGCCCTGACTGTGGCTCCACACAAGTTCCGTACCCACTCAGCACCGGACCCAGTT...

CDS

Download CDS FASTA

1950 bp · LXL04_012392|LXL04_012392|OH1004|CDS

ATGGCGGCCAAAGCCACAATTACTATTATGCTCGCGGTGGCGCTGATTTTAATGACGGCGGATTTCGCCACCTCCGCCACCCGCTGCCCTGACTGTGGCTCCACACAAGTTCCGTACCCACTCAGCACCGGACCCAGTTGCGGCGACCAGTCTTACAGGATCCGGTGCGATGCGAATGCAGGAGCCTTGTACTTCAACAGCATAAACAACACCTATCCAATCTCCTCCATCTCTCAGGCCACCCAACGGTTCGTGATCCG...

Protein

Download Protein FASTA

649 aa · LXL04_012392|LXL04_012392|OH1004|PROTEIN

MAAKATITIMLAVALILMTADFATSATRCPDCGSTQVPYPLSTGPSCGDQSYRIRCDANAGALYFNSINNTYPISSISQATQRFVIRPPTFLNNNTTCVTADISSRGLHLDPNLPFNITSGNTILYLNCSESLLRSPLNCTSTSLCHTYINNSAEASACGRAPLCCTFRTGGSTTTYSIRVRDGGCQAYRSFPNLDYSLPVSRWPDAGVEIQWVSPPEPLCGSQSDCDSSSTCMPSDTAGVRRCFCNTGLHWDAIAGVCA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012392`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012392

Location Chr03:11531315-11535277 (+)

Description Similar to WAKL20: Wall-associated receptor kinase-like 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02070`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At3g53840`	Putative serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21240`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21230`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21210`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	Antisense expression of a cell wall-associated protein kinase, WAK4, inhibits cell elongation and alters morphology.2001 · DOI: 10.1105/tpc.13.6.1317

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012392 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0048527 lateral root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G21210

ath:AT1G21230

ath:AT1G21240

ath:AT3G53840

ath:AT5G02070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.878

Rank 1 · LXL04_012392 · OH-1004

Cytoplasm0.084

Rank 2 · LXL04_012392 · OH-1004

Endoplasmic reticulum0.069

Rank 3 · LXL04_012392 · OH-1004

Nucleus0.051

Rank 4 · LXL04_012392 · OH-1004

Extracellular0.024

Rank 5 · LXL04_012392 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947.12GUB_WAK_bind29-86 aa

PF00069.32Pkinase357-626 aa

PF07714.24PK_Tyr_Ser-Thr359-627 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012392	`PF13947.12`	GUB_WAK_bind	29	86	4.1e-08	34.2
LXL04_012392	`PF00069.32`	Pkinase	357	626	1.1e-44	153.5
LXL04_012392	`PF07714.24`	PK_Tyr_Ser-Thr	359	627	1.6e-47	162.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZM4`	Arabidopsis thaliana	Wall-associated receptor kinase-like 20	55.063%	Swiss-Prot	strong database homology
`Q9M342`	Arabidopsis thaliana	Wall-associated receptor kinase-like 15	49.219%	Swiss-Prot	moderate database homology
`Q9LMN8`	Arabidopsis thaliana	Wall-associated receptor kinase 3	33.430%	Swiss-Prot	moderate database homology
`Q9LMN7`	Arabidopsis thaliana	Wall-associated receptor kinase 5	33.774%	Swiss-Prot	moderate database homology
`Q9LMN6`	Arabidopsis thaliana	Wall-associated receptor kinase 4	32.366%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card