TkA02G562100 | RubberDandelionOmics

Gene overview

TkA02G562100

Reference: TK1151 Chr: Chr02 Coordinates: 145202291-145205985 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1667 bp · TkA02G562100|TK1151|cDNA

GTCCAAACAAAATCCTCTAGTATACAGCTATACAACCGCAACTTCACGTGCAAGTCAAAATAAAACAGTTTATAAAAAAACAATAAATAAATCATTCTTCTTGTTGTACGTAGCACGAAAATCTGCCTTCCCCAAACATGGAGACCAATGGAAGTGATACCAATCTCCGGCGCACACAATCTCCGGCAACTCATCGGAGAATAATTTTGTTTCCCCTGCCATACCAAGGTCATATAAATCCCATGCTCCAGCTAGCAAAC...

CDS

Download CDS FASTA

1413 bp · TkA02G562100|TK1151|CDS

ATGGAGACCAATGGAAGTGATACCAATCTCCGGCGCACACAATCTCCGGCAACTCATCGGAGAATAATTTTGTTTCCCCTGCCATACCAAGGTCATATAAATCCCATGCTCCAGCTAGCAAACATTCTTCACACCCAAGGTTTTAAAATAACCATCATACACACTCAATACAGCGCCCCCAATCATTCAAACTATCCTCACTTCACCTTCAATTCCATCTCTGACCGATTATCCGAGATTGAAAATCATTTACCAATGAA...

Protein

Download Protein FASTA

470 aa · TkA02G562100|TK1151|PROTEIN

METNGSDTNLRRTQSPATHRRIILFPLPYQGHINPMLQLANILHTQGFKITIIHTQYSAPNHSNYPHFTFNSISDRLSEIENHLPMKADAEALYFVKYLNNSCVEPFRECLAGLLEKYGEGSIGCLITDAGFHFTQAVAESLKLPRMVLRTSSVTCLLAWGVLPFFSENDYFNLTKEDPNYESSVPEFPVIKFKDVAKMTTNPDGMRNYVTNMIGHMKASSGLIWNTFKELEEPSLETIRQQFSVPSFALGPFHKYFPAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G562100`
TK1151 ID	TkA02G562100
OH-1004 ID	LXL04_012420
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 100.000 / OH-1004 98.947 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G562100

Location Chr02:145202291-145205985 (-)

Description Similar to UGT76G1: UDP-glycosyltransferase 76G1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11340`	Glycosylates the amino acid-related molecules isoleucic acid (2-hydroxy-3-methylpentanoic acid) and valic acid (2-hydroxy-3- methylbutyric acid).	The Arabidopsis glucosyltransferase UGT76B1 conjugates isoleucic acid and modulates plant defense and senescence.2011 · DOI: 10.1105/tpc.111.088443
`At5g05860`	Involved in the N-glucosylation of cytokinins.	N-glucosylation of cytokinins by glycosyltransferases of Arabidopsis thaliana.2004 · DOI: 10.1074/jbc.m409569200
`At5g05880`	UDP-glycosyltransferase 76C4.	No verified direct reference in this release
`At5g05890`	UDP-glycosyltransferase 76C5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012420 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002239 response to oomycetes Biological Process

GO:0006952 defense response Biological Process

GO:0009690 cytokinin metabolic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0048316 seed development Biological Process

GO:1900000 regulation of anthocyanin catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G11340

ath:AT3G55700

ath:AT5G05860

ath:AT5G05880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.804

Rank 1 · TkA02G562100 · TK1151

Nucleus0.254

Rank 2 · TkA02G562100 · TK1151

Endoplasmic reticulum0.061

Rank 3 · TkA02G562100 · TK1151

Peroxisome0.051

Rank 4 · TkA02G562100 · TK1151

Cell membrane0.045

Rank 5 · TkA02G562100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N22-51 aa

PF00201UDPGT55-154 aa

PF26168Glyco_transf_N206-254 aa

PF00201UDPGT278-434 aa

PF06722EryCIII-like_C336-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G562100	`PF26168`	Glyco_transf_N	22	51	6.6e-07	30.2
TkA02G562100	`PF00201`	UDPGT	55	154	4.2e-32	112.3
TkA02G562100	`PF26168`	Glyco_transf_N	206	254	6.6e-07	30.2
TkA02G562100	`PF00201`	UDPGT	278	434	4.2e-32	112.3
TkA02G562100	`PF06722`	EryCIII-like_C	336	440	5.2e-05	24.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C768`	Arabidopsis thaliana	sp\|Q9C768\|U76B1_ARATH UDP-glycosyltransferase 76B1	48.200%	Swiss-Prot	Medium
`Q9FIA0`	Arabidopsis thaliana	sp\|Q9FIA0\|U76C2_ARATH UDP-glycosyltransferase 76C2	49.700%	Swiss-Prot	Medium
`Q9FI98`	Arabidopsis thaliana	sp\|Q9FI98\|U76C4_ARATH UDP-glycosyltransferase 76C4	47.900%	Swiss-Prot	Medium
`Q9FI97`	Arabidopsis thaliana	sp\|Q9FI97\|U76C5_ARATH UDP-glycosyltransferase 76C5	47.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card