TkA02G544500 | RubberDandelionOmics

Gene overview

TkA02G544500

Reference: TK1151 Chr: Chr02 Coordinates: 140411809-140414520 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · TkA02G544500|TK1151|cDNA

ATGTTTTCCAGTTTATACGAAGATTTTATTGGCAATGGTGGAATCGAGCTTCCAGACATTGAAATCTGGAAACAAATGGTGGCTGGTGTTCCGAAACATGCGAAAGGAAAATGGTCTCTCATCGGAACGAAGCTTTCCGATCTCAAATCCAAACTTTCCGACCTCTCCGACTTCCCCTCTAACTCCCTCTCCGTCGATATCCTCCATTCCCTCTCTCAAACACTCTCTCAAGCACTTTCCTTGTCACTCATTTGTCACAG...

CDS

Download CDS FASTA

624 bp · TkA02G544500|TK1151|CDS

ATGTTTTCCAGTTTATACGAAGATTTTATTGGCAATGGTGGAATCGAGCTTCCAGACATTGAAATCTGGAAACAAATGGTGGCTGGTGTTCCGAAACATGCGAAAGGAAAATGGTCTCTCATCGGAACGAAGCTTTCCGATCTCAAATCCAAACTTTCCGACCTCTCCGACTTCCCCTCTAACTCCCTCTCCGTCGATATCCTCCATTCCCTCTCTCAAACACTCTCTCAAGCACTTTCCTTGTCACTCATTTGTCACAG...

Protein

Download Protein FASTA

207 aa · TkA02G544500|TK1151|PROTEIN

MFSSLYEDFIGNGGIELPDIEIWKQMVAGVPKHAKGKWSLIGTKLSDLKSKLSDLSDFPSNSLSVDILHSLSQTLSQALSLSLICHSANPPGGKLKTQNEVDSISAKVDSHIKDCEVLITSSALHDGVVSTSSASVSKRESIRVESRNLITRLQTGSNESRNSALNSLLGLLQEDDKNVLIAVAQGVVPVLVRLLSIQLRVHCLLQR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G544500`
TK1151 ID	TkA02G544500
OH-1004 ID	LXL04_009312
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	85.900
Protein coverage (%)	TK1151 87.923 / OH-1004 33.213 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G544500`
Location	Chr02:140411809-140414520 (-)
Description	Similar to PUB13: U-box domain-containing protein 13
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009312` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007166 cell surface receptor signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031648 protein destabilization Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050777 negative regulation of immune response Biological Process GO:0051865 protein autoubiquitination Biological Process GO:0090333 regulation of stomatal closure Biological Process GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process GO:2000028 regulation of photoperiodism, flowering Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	ath:AT1G23030 ath:AT1G71020 ath:AT2G28830 ath:AT3G46510 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.503

Rank 1 · TkA02G544500 · TK1151

Nucleus0.462

Rank 2 · TkA02G544500 · TK1151

Cell membrane0.130

Rank 3 · TkA02G544500 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA02G544500 · TK1151

Lysosome / Vacuole0.041

Rank 5 · TkA02G544500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23005DUF703235-122 aa

PF23005DUF7032148-169 aa

PF00514Arm164-182 aa

PF00514Arm176-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G544500	`PF23005`	DUF7032	35	122	1.1e-27	96.8
TkA02G544500	`PF23005`	DUF7032	148	169	1.1e-27	96.8
TkA02G544500	`PF00514`	Arm	164	182	0.084	13.7
TkA02G544500	`PF00514`	Arm	176	196	0.084	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card