TkA02G540990 | RubberDandelionOmics

Gene overview

TkA02G540990

Reference: TK1151 Chr: Chr02 Coordinates: 139581146-139583282 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1525 bp · TkA02G540990|TK1151|cDNA

GAAATTGTGTACATGTGGTGAACATCCAAGAGTGGACCTCATGACCGAGAAGAAACCAGACCGTTATTTTTTTTTACAAGTAATTGACTATTTAAATTTCGCAGTCCCAGGCTCCCACTCCCACTCCCACCCCGTATGCAAATTTAAAAGATAATTTTAGATAGGTTTCCCCGATTCTTCATATATGACACATCACTAAAACGCAGCATAGAGTTTAGATGATTACTCTTGCTTTTCCCCGTCGTTTCATCCCGTAAAGA...

CDS

Download CDS FASTA

825 bp · TkA02G540990|TK1151|CDS

ATGATGCGTGTTACAAATTTGGAAACAATTCCGTTCCCCCGATTATTAAGCTTTGTCCCTAGTCAATTATTCACTCGACACACTACCTTTCGTCGAAACCCATCCCTTTTCACCACCAGTTGCTTAAATGACGTGGCATTGACCATTGCCAGTGACCATAATTATGGCAATAAGCAAGTTATCAGTGTTACTCAAAGAGTATACGACTACTTGCTCACCAACGTTAGAGAACCACCAATATTACGACAACTTAGAGAGGA...

Protein

Download Protein FASTA

274 aa · TkA02G540990|TK1151|PROTEIN

MMRVTNLETIPFPRLLSFVPSQLFTRHTTFRRNPSLFTTSCLNDVALTIASDHNYGNKQVISVTQRVYDYLLTNVREPPILRQLREETANMRGSQMQVSPDQAQLLAMLVQILGANRCIEVGVYTGYSSLAVALVLPESGTLVACERDKNSLEVAKKYYERAGVSHKVDVRHGLAVDTLNSMIENGESCSYDFAFVDAEKRMYHEYFELLLKLVRVGGVIVIDNVLWHGKVADPTVNDKKTESIRSFNRALMEDKRVTIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G540990`
TK1151 ID	TkA02G540990
OH-1004 ID	LXL04_021058
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	93.800
Protein coverage (%)	TK1151 35.036 / OH-1004 80.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G540990

Location Chr02:139581146-139583282 (+)

Description Similar to omt5: Probable caffeoyl-CoA O-methyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26220`	Methylates caffeoyl-CoA to feruloyl-CoA and 5-hydroxyferuloyl-CoA to sinapoyl-CoA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021058 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0017000 antibiotic biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0008171 O-methyltransferase activity Molecular Function

GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function

GO:0042409 caffeoyl-CoA O-methyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ddi:DDB_G0275499

ddi:DDB_G0275501

hsa:118881

mmu:69156

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.895

Rank 1 · TkA02G540990 · TK1151

Mitochondrion0.134

Rank 2 · TkA02G540990 · TK1151

Cytoplasm0.071

Rank 3 · TkA02G540990 · TK1151

Peroxisome0.052

Rank 4 · TkA02G540990 · TK1151

Nucleus0.032

Rank 5 · TkA02G540990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01596Methyltransf_375-273 aa

PF01135PCMT99-173 aa

PF13578Methyltransf_24119-225 aa

PF13649Methyltransf_25120-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G540990	`PF01596`	Methyltransf_3	75	273	1.3e-74	250.6
TkA02G540990	`PF01135`	PCMT	99	173	0.0037	17.8
TkA02G540990	`PF13578`	Methyltransf_24	119	225	9.6e-13	49.7
TkA02G540990	`PF13649`	Methyltransf_25	120	177	0.092	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5D7`	Arabidopsis thaliana	sp\|Q9C5D7\|CAMT3_ARATH Probable caffeoyl-CoA O-methyltransferase At4g26220	41.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card